KEGG   Escherichia coli O9 HS (commensal): EcHS_A0364
Entry
EcHS_A0364        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Other DBs
NCBI-ProteinID: ABV04752
Position
complement(378463..379224)
AA seq 253 aa
MRFVLFCPSGIVPAQFEALSTGSVCNITCIRTEEELRNKLRHRPQSVVISAGRPAECAEM
WFRFYRDHSFVVVLCVAPFFLPPDVSISGVLKNLRLLKTGMSVERAISVANASGGFSGLK
HAENLPVMDSYSVFMNEVNNRTKTIVMSERFPEKQKKVLSLLLAGHSWEYSAQFLKTGIR
QIWLAEQSLKKRWGIPDSMSLREALLLSSNKFHGDGNALEKTNAMTLRENGNTNRYSVVV
NAGTQALSLHKYK
NT seq 762 nt   +upstreamnt  +downstreamnt
atgcgtttcgttcttttctgtccctcaggaattgtacctgcacagtttgaagctctatca
accggttctgtctgcaatattacctgcatcagaacagaagaagagttacgcaataaattg
cggcacaggccgcagagtgtcgtgatatcggcagggcgacctgccgaatgcgctgaaatg
tggttccgattttatcgggatcactcattcgtggtggtgttgtgcgtcgcgccctttttt
ctgccaccggatgtgagtatttctggcgttctcaaaaacctgaggttactgaaaacagga
atgtcagtagagcgtgctatcagtgttgcaaatgcctctggtgggttttcaggactgaaa
catgcagaaaatttgccagttatggacagttactctgtctttatgaatgaggtgaataac
cgcacaaagacaatcgtcatgtcagaacgcttcccggaaaagcaaaagaaggtgttgtcg
ttgcttcttgctggacacagctgggaatacagtgcgcagtttctcaaaacggggataaga
cagatatggcttgctgagcagtcgctaaaaaagcgttggggaataccggacagcatgtca
ttgcgggaagccctgctgctgagcagcaataaatttcacggtgatggaaatgcattggaa
aaaacgaatgccatgacattgcgtgaaaacggaaataccaacaggtattccgtggtggta
aatgcagggacgcaggctttatctctgcataaatataaataa

DBGET integrated database retrieval system