KEGG   Escherichia coli O9 HS (commensal): EcHS_A0365
Entry
EcHS_A0365        CDS       T00591                                 

Definition
(GenBank) HTH luxR-type DNA-binding domain protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: GerE Sigma70_r4_2
Other DBs
NCBI-ProteinID: ABV04753
Position
complement(379378..380172)
AA seq 264 aa
MKKPLVIISACQFTRLALESLIPADRYIVRVYSNVTTEVEFVLKTSCGYLLADIPSLPSG
ELVLLACLVRLRSDAGQWQVCLTGDSDWFDNAPASSLYNGFPHIGTLLKASRYQNQIIRW
LLRPLPGDMSDFWLLTARELSVLKILMQGMSFSEIARYEQRSSKTLHAIATQALRKLGLG
TLSDFRLLYTGCGDSRVKRNIRLHARYVGQHSAHRLTQYVQNMVSGILYPEKVIVGKSIN
SDAISGKVLSGQRKHMSKKRPGVL
NT seq 795 nt   +upstreamnt  +downstreamnt
atgaagaagcctctggttattatcagtgcctgtcagttcaccaggctggcactggagtct
ctcatcccagcggacaggtatatcgtgcgggtgtacagcaacgtcactacagaggttgaa
ttcgttttaaagacctcctgtggctacctgttggctgatatcccttcgcttccttcgggg
gagttagttcttctggcttgtcttgtccgcttgcggagtgatgccgggcaatggcaagtc
tgcctgaccggtgactccgactggttcgataatgctcctgcttcaagtctgtataacggc
ttcccacatatcggcaccttgctgaaagcgagtcgttatcagaatcaaattatccgctgg
ttactacgtcctttacccggcgatatgagtgatttctggctcctgactgcacgggagtta
agcgtgcttaagattctgatgcagggcatgagtttcagtgagattgcccgttatgaacaa
cgcagttcaaagactctgcatgcgattgccacacaggcattaaggaaacttggactggga
acactaagcgatttcaggctgctctatacaggatgcggtgacagcagagtcaaacggaat
atacggctacatgcaagatatgtcggacaacattccgctcatcgactcactcagtatgtg
cagaacatggtgtccggaattctttatccagagaaagttatcgttggtaaatcaataaat
tctgacgccatatccggaaaagtgctttccgggcaaagaaaacatatgtctaaaaaaaga
ccaggagtgttatga

DBGET integrated database retrieval system