KEGG   Escherichia coli O9 HS (commensal): EcHS_A0366
Entry
EcHS_A0366        CDS       T00591                                 

Definition
(GenBank) site-specific recombinase, phage integrase family
  KO
K07357  type 1 fimbriae regulatory protein FimB
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    EcHS_A0366
SSDB
Motif
Pfam: Phage_integrase DUF3435
Other DBs
NCBI-ProteinID: ABV04754
Position
complement(380502..381023)
AA seq 173 aa
MDAAQSMSFPERNRCLIMMAFIHGFRASELLDLRLSDIDASGKQLNIRRIKNGFSTTHPL
LPDEYNLIKLWLKQRKLIENGVEGDWLFLSRKRRPISRQHFFSIIREAGKRAGLAVKAHP
HMLRHACGFALADNGVDTRLLQDYLGHRNIQHTVRYTASNAARFKGVWKKKPR
NT seq 522 nt   +upstreamnt  +downstreamnt
atggatgcagcccagagtatgtcctttcctgaaagaaatcgctgtctaattatgatggct
ttcattcacggttttagggccagtgaacttcttgatttacgtttatccgatattgatgca
tctggaaaacaacttaatattcggcgtattaaaaatggtttctcgacaacacatcctctt
cttcctgatgaatataatttgatcaagttgtggcttaagcagaggaagttaattgaaaac
ggagttgaaggagactggctttttctctcccggaaacgccgccctatcagcagacaacat
tttttttctatcattcgtgaggctggaaaacgtgcaggattagctgtaaaagcacatcct
catatgttacgtcatgcctgtggttttgctctggctgacaatggtgtcgatacccgacta
cttcaggattatctgggtcatcgaaatattcagcatactgtcagatacacagccagtaat
gctgctcgttttaaaggggtgtggaaaaaaaagcctcgttaa

DBGET integrated database retrieval system