KEGG   Escherichia coli O9 HS (commensal): EcHS_A0367
Entry
EcHS_A0367        CDS       T00591                                 

Definition
(GenBank) IS1, transposase orfA
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: HTH_Tnp_IS1 Zn_Tnp_IS1 FdhE zinc_ribbon_4 zinc_ribbon_10 HTH_28 HTH_23 Elf1 zf-Dof
Other DBs
NCBI-ProteinID: ABV04755
Position
complement(381470..381745)
AA seq 91 aa
MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMA
MNGVGCRATARIMGVGLNTILRHLKNSGRSR
NT seq 276 nt   +upstreamnt  +downstreamnt
gtggcttctgtttctatcagctgtccctcctgttcagctactgacggggtggtgcgtaac
ggcaaaagcaccgccggacatcagcgctatctctgctctcactgccgtaaaacatggcaa
ctgcagttcacttacaccgcttctcaacccggtacgcaccagaaaatcattgatatggcc
atgaatggcgttggatgccgggcaactgcccgcattatgggcgttggcctcaacacgatt
ttacgtcacttaaaaaactcaggccgcagtcggtaa

DBGET integrated database retrieval system