KEGG   Escherichia coli O9 HS (commensal): EcHS_A0368
Entry
EcHS_A0368        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Other DBs
NCBI-ProteinID: ABV04756
Position
382383..382478
AA seq 31 aa
MIHLLESISTIFIFRINLLTTFYYQLKINVK
NT seq 96 nt   +upstreamnt  +downstreamnt
ttgattcatttgctggagagtatttcaacaatttttatttttcgcataaacttattaaca
actttttattatcaattgaaaattaatgtaaaataa

DBGET integrated database retrieval system