KEGG   Escherichia coli O9 HS (commensal): EcHS_A0369
Entry
EcHS_A0369        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Other DBs
NCBI-ProteinID: ABV04757
Position
382647..382898
AA seq 83 aa
MLTVSGSEQVTIARNTSGVILKLSGISPAVYQCIHSTFISQIERVRLEFAGEVVTMKHES
YPYVLYNDSVPIPGTVTLNQIGS
NT seq 252 nt   +upstreamnt  +downstreamnt
atgctaaccgtgagcgggagtgaacaagtcaccatagccaggaacactagcggcgtaatt
cttaagctgagtggcatttcacctgcggtttatcagtgcattcatagcaccttcatcagc
cagattgaacgagtccgcttagaatttgctggcgaggttgtcactatgaagcatgagagt
tacccctatgttttatataacgattctgtccccatacctggaacggtaactctcaatcag
atcggttcttga

DBGET integrated database retrieval system