KEGG   Escherichia coli O9 HS (commensal): EcHS_A0370
Entry
EcHS_A0370        CDS       T00591                                 

Gene name
betA
Definition
(GenBank) choline dehydrogenase
  KO
K00108  choline dehydrogenase [EC:1.1.99.1]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00260  Glycine, serine and threonine metabolism
ecx01100  Metabolic pathways
Module
ecx_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EcHS_A0370 (betA)
Enzymes [BR:ecx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.1  choline dehydrogenase
     EcHS_A0370 (betA)
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C FAD_binding_2 DAO Lycopene_cycl NAD_binding_8 Pyr_redox_2 Thi4 HI0933_like
Other DBs
NCBI-ProteinID: ABV04758
UniProt: A7ZWV4
Position
complement(382917..384587)
AA seq 556 aa
MQFDYIIIGAGSAGNVLATRLTEDPNTSVLLLEAGGPDYRFDFRTQMPAALAFPLQGKRY
NWAYETEPEPFMNNRRMECGRGKGLGGSSLINGMCYIRGNALDLDNWAQEPGLENWSYLD
CLPYYRKAETRDVGENDYHGGDGPVSVTTSKPGVNPLFEAMIEAGVQAGYPRTDDLNGYQ
QEGFGPMDRTVTPQGRRASTARGYLDQAKSRPNLTIRTHAMTDHIIFDGKRAVGVEWLEG
DSTIPTRATANKEVLLCAGAIASPQILQRSGVGNAELLAEFDIPLVHELPGVGENLQDHL
EMYLQYECKEPVSLYPALQWWNQPKIGAEWLFGGTGVGASNHFEAGGFIRSREEFAWPNI
QYHFLPVAINYNGSNAVKEHGFQCHVGSMRSPSRGHVRIKSRDPHQHPAILFNYMSHEQD
WQEFRDAIRITREIMHQPALDQYRGREISPGTECQTDEQLDEFVRNHAETAFHPCGTCKM
GYDEMSVVDGEGRVHGLEGLRVVDASIMPQIITGNLNATTIMIGEKIADMIRGQEALPRS
TAGYFVANGMPVRAKK
NT seq 1671 nt   +upstreamnt  +downstreamnt
ttgcaatttgactacatcattattggtgccggctcagccggcaacgttctcgctacccgt
ctgactgaagatccgaatacctccgtgctgctgcttgaagcgggcggcccggactatcgc
tttgacttccgcacccagatgcccgcagcgctggcgttcccactacagggcaaacgctac
aactgggcctatgaaacagagcctgaaccgtttatgaataaccgccgcatggagtgcgga
cgcggtaaaggcctgggtggatcgtcgctgatcaacggcatgtgctacatccgtggcaat
gcgctggatctcgataactgggcgcaagaacccggtctggagaactggagttatctcgac
tgcctgccctactaccgcaaggccgagactcgcgatgtgggcgagaacgactaccacggt
ggcgatggcccggtgagcgtcaccacctccaaacccggcgtcaatccgctgtttgaagcg
atgattgaagcgggcgtgcaggcaggctacccgcgcacggacgatctcaacggctatcag
caggaaggttttggcccgatggatcgcaccgtcacgccgcagggccgtcgcgccagtacc
gcgcgcggttatctcgatcaggccaaatcgcgccctaacctgaccattcgtactcacgct
atgaccgatcacatcatttttgacggcaaacgcgcggtgggcgtcgaatggctggaaggc
gacagcaccatcccaacccgcgcaacggccaacaaagaagtgctgttatgtgcaggcgcg
attgcctcaccgcagatcctgcaacgctccggcgtcggcaacgctgaactgctggcggag
tttgatattccgctggtgcatgaattacccggcgtcggcgaaaatcttcaggatcatctg
gagatgtatctgcaatatgagtgcaaagaaccggtttccctctaccctgccctgcagtgg
tggaaccaaccgaaaatcggtgcggagtggctgtttggcggcactggcgttggtgccagc
aaccactttgaagcaggtggatttattcgcagccgtgaggaatttgcgtggccgaatatt
cagtaccatttcctgccagtagcgattaactataacggctcgaatgcagtgaaagagcac
ggtttccagtgccacgtcggctcaatgcgctcgccaagccgtgggcatgtgcggattaaa
tcccgcgacccgcaccagcatccggcgattctgtttaactacatgtcgcacgagcaggac
tggcaggagttccgcgacgcaattcgcatcacccgggagatcatgcatcaaccggcgctg
gatcagtatcgtggccgcgaaatcagccccggcacggaatgtcagacggatgaacagctc
gatgagttcgtgcgtaatcacgccgaaaccgccttccatccgtgcggtacctgcaaaatg
ggctacgacgagatgtccgtggttgacggcgaaggccgcgtacacgggttagaaggcctg
cgtgtggtggatgcgtcgattatgccgcagattatcaccgggaatttgaacgccacgaca
attatgattggcgagaaaatagcggatatgattcgtggacaggaagcgctgccgaggagc
acggcgggatattttgtggcaaatgggatgccggtgagagcgaaaaaatga

DBGET integrated database retrieval system