KEGG   Escherichia coli O9 HS (commensal): EcHS_A0371
Entry
EcHS_A0371        CDS       T00591                                 

Gene name
betB
Definition
(GenBank) betaine aldehyde dehydrogenase
  KO
K00130  betaine-aldehyde dehydrogenase [EC:1.2.1.8]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00260  Glycine, serine and threonine metabolism
ecx01100  Metabolic pathways
Module
ecx_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EcHS_A0371 (betB)
Enzymes [BR:ecx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.8  betaine-aldehyde dehydrogenase
     EcHS_A0371 (betB)
SSDB
Motif
Pfam: Aldedh Peptidase_C2
Other DBs
NCBI-ProteinID: ABV04759
UniProt: A7ZWV5
Position
complement(384601..386073)
AA seq 490 aa
MSRMAEQQLYIHGGYTSATSGRTFETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIW
AAMTAMERSRILRRAVDILRERNDELAKLETLDTGKAYSETSTVDIVTGADVLEYYAGLI
PALEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEV
TPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEHPGIAKVSFTGGVASGKKVMAN
SAASSLKEVTMELGGKSPLIVFDDADLDLAADIAMMANFFSSGQVCTNGTRVFVPAKCKA
AFEQKILARVERIRAGDVFDPQTNFGPLVSFPHRDNVLRYIAKGQEEGARVLCGGDVLKG
DGFDNGAWVAPTVFTDCRDDMTIVREEIFGPVMSILTYETEDEVIRRANDTDYGLAAGIV
TADLNRAHRVIHQLEAGICWINTWGESPAEMPVGGYKHSGIGRENGVMTLQSYTQVKSIQ
VEMAKFQSIF
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgtcccgaatggcagaacagcagctttatatacatggtggttatacctccgccaccagc
ggtcgcaccttcgagaccattaacccggccaacggtaacgtgctggcgaccgtgcaggcc
gccgggcgtgaggatgtcgatcgcgccgtgaagagtgcccaacaggggcaaaaaatctgg
gcggcgatgaccgctatggagcgctcgcgtattctgcgtcgggccgttgatattctgcgt
gaacgcaatgacgaactcgcaaaactggaaaccctcgataccggaaaagcatattcggaa
acctcaaccgtcgatatcgttaccggtgcggacgtgctggagtactacgccgggctgatc
ccggcgctggaaggcagccagatcccgttgcgtgagacgtcatttgtttatacccgccgc
gaaccgctgggtgtggtggcggggattggcgcatggaactacccgattcagattgccctg
tggaaatccgccccggcgctggcggcaggcaacgcaatgattttcaaaccgagcgaagtc
accccgcttaccgcgttaaagctggctgaaatttacagcgaagcgggcctgccggacggc
gtatttaacgtgttgccgggggtgggcgcggagaccgggcaatatctgaccgagcatccg
ggcattgccaaagtgtcatttaccggcggtgtcgccagcggcaaaaaagtgatggctaac
tcggcggcctcttccctgaaagaagtgaccatggaactgggcggtaaatcaccgctgatc
gttttcgatgatgcggatctcgatctcgccgccgatatcgccatgatggcgaacttcttc
agctccggtcaggtgtgtaccaatggcacccgcgtcttcgttccggcgaaatgcaaagcc
gcatttgaacaaaagattctggcgcgcgttgagcgcattcgcgcgggcgacgttttcgat
ccgcaaaccaatttcggcccgctggtcagcttcccgcatcgcgataacgtgctgcgctat
atcgccaaaggccaagaggaaggcgcgcgcgtactgtgcggcggcgatgtactgaaaggc
gatggcttcgataacggcgcatgggtggcaccgaccgtgttcaccgattgccgcgacgat
atgaccattgtgcgtgaagagatcttcgggccggtgatgtccattctgacctacgagacg
gaagacgaagtcattcgccgcgccaatgataccgactatggtctggcggcgggtatcgtg
acggcggacctgaaccgcgcgcatcgcgtcattcatcagctggaagcgggtatttgctgg
atcaatacctggggtgaatccccggcagagatgcccgttggcggctacaaacactccggc
attggtcgcgagaacggcgtgatgacgctccagagttacacccaggtgaagtccatccag
gttgagatggctaaattccagtccatattctaa

DBGET integrated database retrieval system