KEGG   Escherichia coli O9 HS (commensal): EcHS_A0372
Entry
EcHS_A0372        CDS       T00591                                 

Gene name
betI
Definition
(GenBank) transcriptional repressor BetI
  KO
K02167  TetR/AcrR family transcriptional regulator, transcriptional repressor of bet genes
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecx03000]
    EcHS_A0372 (betI)
Transcription factors [BR:ecx03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    EcHS_A0372 (betI)
SSDB
Motif
Pfam: TetR_C_6 TetR_N LacI DUF3390 DUF1744 HTH_3 TetR_C_31
Other DBs
NCBI-ProteinID: ABV04760
UniProt: A7ZWV6
Position
complement(386087..386674)
AA seq 195 aa
MPKLGMQSIRRRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEAT
MRDITSQLRDAVLNRLHALPQGSAEQRLQAIVGGNFDETQVSSAAMKAWLAFWASSMHQP
MLYRLQQVSSRRLLSNLVSEFRRELPRQQAQEAGYGLAALIDGLWLRAALSGKPLDKPLA
HSLTRHFITQHLPTD
NT seq 588 nt   +upstreamnt  +downstreamnt
atgcccaaattggggatgcagtcgatccggcgcagacaactgatcgacgccacactggaa
gcaataaatgaagtgggcatgcacgatgcaacgatcgcgcagatcgcccgccgtgcaggc
gtttctacggggatcatcagccactatttcagggacaaaaatggtctgctggaagcaacc
atgcgcgatatcaccagtcagctgcgtgacgcggttttgaatcgattacatgcacttccg
cagggcagtgcagagcagcgattacaggcgattgttggcggaaacttcgatgaaacgcag
gtgagcagtgcggcgatgaaagcctggctggcgttctgggccagcagtatgcatcagccg
atgctctatcgtttacagcaggtcagtagccgccgcttattgtcgaatctggtgagcgaa
tttcgccgcgagttaccgcgccaacaggcacaggaagcgggctacggccttgccgcgctg
attgacggattatggctgcgcgcggcactgagcggcaaaccgctggataaacctctcgca
cactcgctgacccgtcactttattactcagcatttacccaccgattaa

DBGET integrated database retrieval system