KEGG   Escherichia coli O9 HS (commensal): EcHS_A0373
Entry
EcHS_A0373        CDS       T00591                                 

Gene name
betT
Definition
(GenBank) transporter, betaine/carnitine/choline transporter (BCCT) family
  KO
K02168  choline/glycine/proline betaine transport protein
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecx02000]
    EcHS_A0373 (betT)
Transporters [BR:ecx02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   EcHS_A0373 (betT)
SSDB
Motif
Pfam: BCCT
Other DBs
NCBI-ProteinID: ABV04761
Position
386803..388836
AA seq 677 aa
MTDLSHSREKDKINPVVFYTSAGLILLFSLTTILFRDFSALWIGRTLDWVSKTFGWYYLL
AATLYIVFVVCIACSRFGSVKLGPEQSKPEFSLLSWAAMLFAAGIGIDLMFFSVAEPVTQ
YMQPPEGAGQTIEAARQAMVWTLFHYGLTGWSMYALMGMALGYFSYRYNLPLTIRSALYP
IFGKRINGPIGHSVDIAAVIGTIFGIATTLGIGVVQLNYGLSVLFDIPDSMAAKAALIAL
SVIIATISVTSGVDKGIRVLSELNVALALGLILFVLFMGDTSFLLNALVLNVGDYVNRFM
GMTLNSFAFDRPVEWMNNWTLFFWAWWVAWSPFVGLFLARISRGRTIRQFVLGTLIIPFT
FTLLWLSVFGNSALYEIIHGGAAFAEEAMVHPERGFYSLLAQYPAFTFSASVATITGLLF
YVTSADSGALVLGNFTSQLKDINSDAPGWLRVFWSVAIGLLTLGMLMTNGISALQNTTVI
MGLPFSFVIFFVMAGLYKSLKVEDYRRESANRDTAPRPLGLQDRLSWKKRLSRLMNYPGT
RYTKQMMETVCYPAMEEVAQELRLRGAYVELKSLPPEEGQQLGHLDLLVHMGEEQNFVYQ
IWPQQYSVPGFTYRARSGKSTYYRLETFLLEGSQGNDLMDYSKEQVITDILDQYERHLNF
IHLHREAPGHSVMFPDA
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgacagacctttcacacagcagggaaaaggacaaaatcaatccggtggtgttttacacc
tccgccggactgattttgttgttttccctgacaacgatcctgtttcgcgacttctcggcc
ctgtggattggccgcacgctggactgggtttctaaaaccttcggttggtactatctactg
gcggcaacgctctatattgtctttgtggtctgtatcgcttgttcgcgttttggttcggtg
aagctcgggccagaacaatccaaaccggaattcagcctgctgagttgggcggcgatgctg
tttgctgccgggatcggtatcgacctgatgttcttctccgtagccgaaccggtaacgcag
tatatgcagccgccggaaggcgcgggacagacgattgaggccgcgcgtcaggcgatggtc
tggacgctgtttcactacggcttaaccggctggtcgatgtatgcgctgatgggcatggcg
ctcggatactttagctatcgttataatttgccgctcaccatccgctcggcgctgtacccg
atcttcggtaaacggattaacgggccgatagggcactcagtggatattgcagcggtgatc
ggcaccatcttcggtattgccactacgctcggtatcggtgtggtgcagcttaactatggc
ttgagcgtactgtttgatattcccgattcgatggcggcaaaagcggcactgatcgccttg
tcggtgataatcgccacgatctctgtcacctccggtgtcgataaggggattcgtgtgtta
tcggaacttaacgttgcgctggcgctgggattgatcctgttcgtattgtttatgggcgac
acctcgttcctgcttaatgcgctggtgctgaatgttggcgactatgtgaatcgctttatg
ggcatgacgctcaacagttttgccttcgaccgtccagttgagtggatgaataactggacg
ctcttcttctgggcatggtgggtggcatggtcgccgtttgtcggcttgttcctggcgcgt
atctcgcgtgggcgtaccattcgccagttcgtgctgggcacgttgattattccgtttacc
ttcacgctgttatggctctcggtgttcggcaatagcgcgctgtatgaaatcatccacggc
ggcgcggcatttgccgaggaagcgatggtccatccggagcgcggcttctacagcctgctg
gcgcagtatccggcgtttacctttagcgcctccgtcgccaccattactggcctgctgttt
tatgtgacctcggcggactccggtgcgctggtgctggggaatttcacctcgcagcttaaa
gatatcaacagcgacgcccccggctggctgcgcgtcttctggtcggtggcgattggcctg
ctgacgctcggcatgctgatgaccaacgggatatccgcgctgcaaaacaccacggtgatt
atggggctgccgttcagctttgtgatcttcttcgtgatggcggggttgtataaatctctg
aaggtagaagattaccgccgtgaaagtgccaaccgcgataccgcaccgcgaccgctgggg
cttcaggatcgcctgagctggaaaaaacgtctctcgcgcctgatgaattatccgggcacg
cgttacactaaacagatgatggagacggtctgttacccggcaatggaagaagtggcgcag
gagctgcggttgcgcggcgcatacgtggagctaaaaagcctgccgccggaagagggacaa
cagttggggcatctggatttgttggtgcatatgggcgaagaacaaaactttgtctatcag
atttggccgcagcaatattcggtgccgggctttacctaccgcgcacgtagcggtaaatcg
acctactaccggctggaaaccttcctgttagaaggcagccagggcaacgacctgatggac
tacagcaaagagcaggtgatcaccgatattcttgaccagtacgagcggcaccttaacttt
attcatctccatcgtgaagcgccgggccatagcgtgatgttcccggacgcgtga

DBGET integrated database retrieval system