KEGG   Escherichia coli O9 HS (commensal): EcHS_A0374
Entry
EcHS_A0374        CDS       T00591                                 

Definition
(GenBank) putative outer membrane autotransporter
  KO
K12678  autotransporter family porin
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecx02000]
    EcHS_A0374
   02044 Secretion system [BR:ecx02044]
    EcHS_A0374
Transporters [BR:ecx02000]
 Other transporters
  Pores ion channels [TC:1]
   EcHS_A0374
Secretion system [BR:ecx02044]
 Type V secretion system
  Autotransporter-1 (AT-1) family
   EcHS_A0374
SSDB
Motif
Pfam: Autotransporter AC_1 ESPR Trypan_PARP AbrB-like
Other DBs
NCBI-ProteinID: ABV04762
Position
389409..393392
AA seq 1327 aa
MNKIYRLKWNRSRNCWSVCSELGSRVKGKKSRAVLISAISLYSSLVFADDVIVNQDKTID
FGKENQSIDYRITVTDNANLVINTTDTSRPRLTLASGGGLDITGGKVTINGPLNFLLKGT
GFLNVSNAGSELYADDLYESNSGMRHDQGYFNVSNGGKIHVKGTSRLTYTQGNVSGEGSQ
VNAGTFFMGVYGGYGGNQFLSVNNGGEVNAREHISLGYYDQRSDTTLVVSDGGKISAPKI
SLSTNSELALGAQEGSAAKAAGIIDAEKIEFVWAKTSDKKITLNHTDKNATISADIVSGS
EGLGYINALNGTTYLTGDNSAFSGKVKIEQNGALGITQNIGTAEINNRGKLHLKADDSMT
FANKISGNGTISIDSGTVALTGNNYAFSGYIDVASGAVAVISEDKNIGRADLDVDGKLQI
NANKDWVFDNDLQGRGIVEINMGNHEFSFDEFAYTDWFQGSLAFQNTTFNLEKNAEFLQR
GGITAGQGSQVTVGKGAHSISTLGFSGGTVDFGALTAGAQMTEGTVNVSKTLDLRGEGVI
QVSDSDVVSSVSRDIDSALSLTEVDDGNSTIKLVDAQGAEVLGDAGNLQLQDKNGQILSS
SAQRDIQQNGQKAAVGTYDYRLTSGVNNDGLYIGYGLTQLDLHATDSDALVLSSNGKSEN
AADLSAKITGSGDLAFSSQKGQTVSLSNKDNDYTGVTDLRSGTLLLNNDNVLGNTHELRL
AAETELDMNGHSQTVGTLNGSADSLLSLNGGSLTVTNGGTSTGSLTGSGELNIQGGTLDI
AGDNSNLTANVNIANSANVLVSHAQGLGSANVENNGTLALNNSAEKRAAASVNYTLGGNL
TNNGTLMTGMSGQQAGNVLVVKGNYHGNNGQLVMNTVLNGDDSVTDKLVVEGDTSGTTAV
TVNNAGGTGAKTLNGIELIHVDGKSEGEFVQAGRIVAGAYDYTLARGQGANSGNWYLTSG
SDSPELQPEPDPMPNPEPNPNPEPNPNPTPTPGPDLNVDNDLRPEAGSYIANLAAANTMF
TTRLHERLGNTYYTDMVTGEQKQTTMWMRHEGGHSKWRDGSGQLKTQSNRYVLQLGGDVA
QWSQNGSDSWHVGVMAGYGNSDSKTISSRTGYRAKASVNGYSTGLYATWYADDESRNGAY
LDSWAQYSWFDNTVKGDDLQSESYKSKGFTASLEAGYKHKLAEFNGSQGTRNEWYVQPQA
QVTWMGVKADKHRESNGTLVHSNGDGNVQTRLGVKTWLKSHHKMDDGKSREFQPFVEVNW
LHNSKDFSTSMDGVSVTQDGARNIAEIKTGVEGQLNANLNVWGNVGVQVADRGYNDTSAM
VGIKWQF
NT seq 3984 nt   +upstreamnt  +downstreamnt
atgaataaaatatatcggctaaagtggaacaggtcccgtaactgttggagcgtctgctct
gagctggggagcagagtaaaaggaaaaaagtcccgggctgttttaattagcgcgataagt
ttatattcatctctggtattcgccgatgatgtcatcgtaaaccaggataaaactattgat
tttggcaaagagaaccagagcatcgattaccgtattacggtgactgacaatgccaatctg
gtaatcaatacgacagatacttcccgtccgcgtctgactctcgcttctggtggtgggttg
gatattaccggaggaaaggtaacaatcaatggcccgcttaactttttgctgaaaggtacg
gggttcctgaatgtctccaatgctggcagcgagttatatgctgatgatttgtatgagtca
aactcaggcatgagacatgatcaaggctattttaatgtctccaatggcggcaaaattcat
gttaagggcaccagtcgtctgacttatacgcaggggaatgtaagcggcgaaggtagtcag
gtaaatgcagggaccttctttatgggcgtttacggcggatatggcggtaatcagttcctg
tcggttaataacggtggtgaagttaatgctcgtgaacatattagcctgggttattacgac
caacgttctgatacaacattagtcgtatcagatggaggtaaaatatccgcaccgaaaatt
agtttaagcaccaactctgagttagcgttaggtgcacaggaaggaagtgctgcgaaggct
gcagggattattgatgccgaaaaaattgagtttgtgtgggcaaagacatccgataagaaa
atcaccttaaaccacacggataaaaacgcgactatttccgcggatattgtcagtggcagc
gagggcctgggctatatcaatgcgctcaatggcacgacttacttaaccggtgataactct
gcctttagtggtaaagtcaaaattgagcaaaatggcgctttagggatcacccaaaatata
ggtacagcagagatcaacaaccgcgggaaattacacctgaaggctgacgatagcatgacc
tttgccaataagatttccggcaatggtacaataagtatcgacagtgggacagtggcactg
accggcaataactatgcattcagcggatatattgatgtcgcttctggtgctgtcgcggtt
atttctgaagacaagaacatcggccgtgcggacctggatgttgatggcaaactgcaaatc
aatgccaataaagattgggtatttgataacgatcttcaaggtagaggtattgttgaaata
aacatggggaatcacgaattctccttcgatgagtttgcttatacagactggttccagggt
tcactggcgttccagaacacgacatttaacctggaaaagaatgctgagtttctgcagaga
ggcgggatcactgcgggtcagggaagccaggtaacagtgggtaagggcgctcactccatt
agcactttgggattctccggcggaaccgttgattttggtgccctgacagcaggtgcacag
atgacagaagggacggtcaacgttagtaaaacgctggatttgcgcggcgagggtgtgatt
caggtttctgacagtgacgttgtaagctcagtatctcgtgatattgactctgcgttatcg
ctcactgaagtcgatgatggtaacagcaccattaagttggttgatgcgcaaggtgcggaa
gttctgggcgatgcgggcaatctgcaattgcaggataaaaatgggcaaatcctctccagc
agtgcccaacgtgatattcagcagaatgggcaaaaagcggccgtcggcacttacgactat
cgtctgacgagtggggtaaacaatgacggtctgtatatcggttacggcctgacccagctt
gatttacacgctaccgacagcgatgctctggtgctgagctctaacggtaaaagcgagaat
gccgccgatctcagcgcaaagattaccggcagtggtgacctggcattcagcagccagaag
ggtcagaccgtatcgctttctaacaaagacaacgactataccggtgttaccgatctgcgc
agtgggacgcttttgttgaataacgataacgtgttgggtaatacccatgaactgcgtctg
gcggcagagactgaactggatatgaatggtcacagccagaccgtgggcacgctcaatggc
agcgccgattcactgctgagcttaaatggcggcagtctgacggttaccaacgggggcact
tcaaccggttcgttaacggggagcggagagctgaatattcagggcggcacgctggacatc
gcgggcgataacagcaacctgacggcgaatgtgaacattgctaattcggctaatgtcctg
gtaagtcatgcgcagggattgggtagcgcaaacgttgagaacaacggtaccctggcgttg
aataatagcgctgaaaaaagagcggctgcgtctgtgaattacaccctgggcggcaatctg
accaacaacggtacgctgatgaccggaatgtcaggacagcaagctggcaatgtgttagtg
gtgaaggggaactaccacggtaataacggtcaactagtaatgaatacggtactgaatggc
gatgactcagtaaccgataaattggttgtcgagggcgatactagcggcacgactgccgtt
acggtgaataacgctggcggtacaggtgcgaaaacccttaacggtatcgaacttatccat
gtagacggtaagtctgagggcgaatttgttcaggctggtcgtatcgttgcgggggcgtat
gactacactctcgcgcgtggacaaggggcaaatagtggtaactggtatctgaccagcggc
agtgattctcctgaactgcagccggagccagacccgatgccgaatccggagccaaacccg
aatccagagccgaaccctaacccgacacctacgccgggtccggatctgaatgtggataat
gacctgcgaccggaggcgggtagctacattgcgaaccttgcagcagcgaatacaatgttc
accacgcgtctgcatgagcgtctgggtaatacgtactataccgacatggtgacgggtgag
cagaaacaaaccactatgtggatgcgccatgaaggtggtcatagtaaatggcgtgatggc
agcggccagctgaaaacccaaagcaatcgctatgttctgcaactgggaggcgatgtcgcg
cagtggagccaaaacggcagcgacagctggcatgttggggtcatggcgggatatggcaac
agcgacagcaaaaccatttcctcgcgaaccggttatcgtgcaaaagcgagtgtgaacgga
tatagcaccggcctctatgccacctggtatgccgatgacgagtcgcgtaatggcgcgtat
ctcgacagttgggcgcagtacagctggtttgataacacagtgaaaggggatgacttacaa
agtgaatcctataaatcaaaaggatttaccgcttcactggaagctggatacaaacacaaa
ttagctgaatttaatggcagccagggaacgcgtaatgaatggtatgttcagccgcaagca
caggttacctggatgggagtcaaagccgataagcaccgcgaaagcaacggaaccctcgtt
catagcaacggtgatggcaatgttcaaacccgacttggcgtaaaaacctggctgaagagc
caccataaaatggatgacggtaaatcccgcgagttccagccgtttgtagaagtgaactgg
ctgcataacagtaaggatttcagcaccagtatggatggcgtgtccgtcactcaggatgga
gcccgaaatattgctgagataaaaaccggggtggaaggacagctaaatgccaacctgaat
gtctgggggaatgtgggcgttcaggttgccgataggggatataatgacacctctgcaatg
gttggcattaagtggcaattctga

DBGET integrated database retrieval system