KEGG   Escherichia coli O9 HS (commensal): EcHS_A0412Help
Entry
EcHS_A0412        CDS       T00591                                 

Gene name
mhpB
Definition
(GenBank) 2,3-dihydroxyphenylpropionate 1,2-dioxygenase
  KO
K05713  2,3-dihydroxyphenylpropionate 1,2-dioxygenase [EC:1.13.11.16]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00360  Phenylalanine metabolism
ecx01100  Metabolic pathways
ecx01120  Microbial metabolism in diverse environments
ecx01220  Degradation of aromatic compounds
Module
ecx_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    EcHS_A0412 (mhpB)
Enzymes [BR:ecx01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.16  3-carboxyethylcatechol 2,3-dioxygenase
     EcHS_A0412 (mhpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigB
Motif
Other DBs
NCBI-ProteinID: ABV04799
UniProt: A7ZWZ5
Position
434783..435727
Genome map
AA seq 314 aa AA seqDB search
MHAYLHCLSHSPLVGYVDPAQEVLDEVNGVIASARERIAAFSPELVVLFAPDHYNGFFYD
VMPPFCLGVGATAIGDFGSAAGELPVPVELAEACAHAVMKSGIDLAVSYCMQVDHGFAQP
LEFLLGGLDKVPVLPVFINGVATPLPGFQRTRMLGEAIGRFTSTLNKRVLFLGSGGLSHQ
PPVPELAKADAHMRDRLLGSGKDLPASERELRQQRVISAAEKFVEDQRTLHPLNPIWDNQ
FMTLLEQGRIQELDAVSNEELSAIAGKSTHEIKTWVAAFAAISTFGNWRSEGRYYRPIPE
WIAGFGSLSARTEN
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcttatcttcactgtctttcccactcgccgctggtggggtatgtcgacccggcg
caagaggtgctcgatgaggtcaatggcgtgattgccagcgcccgcgagcgtattgcggca
ttctcccctgaactggtggtgctgtttgcgccagatcactacaacggctttttctatgac
gtgatgccaccgttctgtttaggcgttggagcgacggcaattggtgatttcggcagtgcg
gcaggagagctgcccgtgcctgtggagctggcggaggcctgtgcgcatgctgtcatgaag
agcgggatcgatcttgccgtttcttactgtatgcaggtggaccacgggttcgcccagccg
ctggagttcctgctcggtgggctggataaggtgccagttctgcctgtgttcatcaacggt
gtcgccacgccgctgcccggtttccagcgtacccgcatgttgggtgaagccattggacgt
ttcaccagcactctcaataaacgcgtgctgttcctgggttccggtgggctttcccatcag
ccgccggtgcccgaactggcgaaagccgatgcccatatgcgcgaccgtctgttggggagc
gggaaagatttacccgccagtgagcgcgaattgcgtcagcaacgggtgattagcgccgct
gagaagtttgttgaggatcagagaactctgcatccgctcaacccgatttgggataaccag
ttcatgactttgctggagcagggacgcatacaggaactggatgccgtcagtaacgaagag
ctttccgccattgccggaaagtcgacacatgaaatcaaaacctgggtcgccgcttttgcc
gctatttctacatttggcaactggcgtagcgaagggcgttattaccgcccaatcccggag
tggattgccggatttggctcgttaagcgccagaacagagaactga

DBGET integrated database retrieval system