KEGG   Escherichia coli O9 HS (commensal): EcHS_A0474Help
Entry
EcHS_A0474        CDS       T00591                                 

Gene name
acpH
Definition
(GenBank) acyl carrier protein phosphodiesterase
  KO
K08682  acyl carrier protein phosphodiesterase [EC:3.1.4.14]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    EcHS_A0474 (acpH)
Enzymes [BR:ecx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.14  [acyl-carrier-protein] phosphodiesterase
     EcHS_A0474 (acpH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_PD
Motif
Other DBs
NCBI-ProteinID: ABV04859
UniProt: A7ZX55
Position
complement(488129..488710)
Genome map
AA seq 193 aa AA seqDB search
MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMHRRIDVLTDNLPEVRE
AREWFRSETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFVCYAREQVMTILPDSPPRF
INLNNYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSWYDLDAHYDALETRFWQF
YPRMMAQASHKAL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaattttttagctcacctgcatttagcccatctcgcggaaagctcgctttccggcaat
ttactggctgatttcgtacgcggaaatcctgaagaaagttttccgcccgacgtcgtggct
ggcattcatatgcatcgacgtatcgacgtattaaccgacaatctgccggaagtccgcgaa
gcacgggaatggtttcgtagtgaaactcgccgcgttgcgcctattacgctggatgtcatg
tgggatcactttctttcccgccactggtcgcagctgtcgccggactttccgctacaggaa
tttgtctgttatgcccgcgagcaagtgatgacgattttgccggactcaccgccacgtttt
atcaatctgaacaattacttgtggtcagagcagtggctggtgcgctatcgcgatatggat
ttcatccagaacgtgttaaacggcatggcaagccgccgcccacgtctggatgccctgcgt
gactcctggtacgatttagacgctcattatgacgccctcgaaacccgcttctggcagttt
tatccgcggatgatggcgcaggcgtcacacaaggcgttataa

DBGET integrated database retrieval system