KEGG   Escherichia coli O9 HS (commensal): EcHS_A1065
Entry
EcHS_A1065        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09911  uncharacterized protein
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    EcHS_A1065
SSDB
Motif
Pfam: MatP MatP_C RHH_4 TMF_TATA_bd
Other DBs
NCBI-ProteinID: ABV05412
UniProt: A7ZYQ8
Structure
PDB: 
4D8J

Position
1080099..1080551
AA seq 150 aa
MKYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQEAVDVLLSLENEPVLVNGWIDK
HMNPELVNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFIVWQRLAGLAQRRGKTLSETIV
QLIEDAENKEKYANKMSSLKQDLQALLGKE
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaatatcaacaacttgaaaatcttgaaagcggttggaaatggaagtatctggttaag
aagcatcgcgaaggggagttaatcacccgttacatagaagccagtgccgcccaggaagcc
gtcgatgtgttgctctcgctggaaaatgaacccgtgctggtaaatggctggattgacaag
catatgaatccggaactggtcaatcgcatgaagcaaaccattcgggcaagacgaaagcgc
cattttaatgcggaacaccagcatacgcgcaaaaaatcgatcgatctggaatttattgtc
tggcaacgtctggctggtcttgcgcagcgtcgcggtaaaacgctttctgaaacgattgtt
cagctgattgaagatgcggaaaacaaagagaaatacgcgaataaaatgtcttctctgaag
caggatctgcaggcattgctgggtaaggaataa

DBGET integrated database retrieval system