KEGG   Escherichia coli O9 HS (commensal): EcHS_A1804Help
Entry
EcHS_A1804        CDS       T00591                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00010  Glycolysis / Gluconeogenesis
ecx00030  Pentose phosphate pathway
ecx00051  Fructose and mannose metabolism
ecx00052  Galactose metabolism
ecx00680  Methane metabolism
ecx01100  Metabolic pathways
ecx01110  Biosynthesis of secondary metabolites
ecx01120  Microbial metabolism in diverse environments
ecx01130  Biosynthesis of antibiotics
ecx01200  Carbon metabolism
ecx01230  Biosynthesis of amino acids
Module
ecx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcHS_A1804 (pfkB)
   00030 Pentose phosphate pathway
    EcHS_A1804 (pfkB)
   00051 Fructose and mannose metabolism
    EcHS_A1804 (pfkB)
   00052 Galactose metabolism
    EcHS_A1804 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    EcHS_A1804 (pfkB)
Enzymes [BR:ecx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EcHS_A1804 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: ABV06118
Structure
PDB: 

Position
1823171..1824100
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
AGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIIDSSGEALSAALAIGN
IELVKPNQKELSTLVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattaccccg
caaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccgggggcggc
ggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttcccg
gcgggtggcgcgaccggcgaacacctggtttcactgttggcggatgaaaatgtccccgtt
gctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagcaagc
ggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgccag
cttgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaaggg
atccgctgcatcatcgacagttctggcgaagcgttaagtgcagcactggcgattggtaac
atcgagttggttaagcctaaccaaaaagaactcagtacgctggtgaatcgcgaactcacc
cagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaacgg
gttgtcgtttcccttggtccacaaggagcgctgggtgttgatagtgaaaactgcattcag
gtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgacagcatggtcggc
gcgatgacactgaaactggcagaaaatgcctctcttgaagagatggttcgttttggcgta
gctgcggggagtgcagccacactcaatcagggtacacgtctgtgctcccatgacgatacg
caaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system