KEGG   Escherichia coli O9 HS (commensal): EcHS_A1848Help
Entry
EcHS_A1848        CDS       T00591                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00450  Selenocompound metabolism
ecx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EcHS_A1848 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ecx03016]
    EcHS_A1848 (selD)
Enzymes [BR:ecx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     EcHS_A1848 (selD)
Transfer RNA biogenesis [BR:ecx03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    EcHS_A1848 (selD)
 Prokaryotic Type
    EcHS_A1848 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ABV06161
UniProt: A8A0V7
Structure
PDB: 

Position
complement(1865047..1866090)
Genome map
AA seq 347 aa AA seqDB search
MSENSIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNG
TSVISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINKLSPEIARE
VTEGGRYACRQAGIALAGGHSIDAPEPIFGLAVTGIVPTERVKKNSTAQAGCKLFLTKPL
GIGVLTTAEKKSLLKPEHQGLATEVMCRMNIAGASFANIEGVKAMTDVTGFGLLGHLSEM
CQGAGVQARVDYEAIPKLPGVEEYIKLGAVPGGTERNFASYGHLMGEMPREVRDLLCDPQ
TSGGLLLAVMPEAENEVKATAAEFGIELTAIGELVPARGGRAMVEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaactcgattcgtttgacccaatacagccacggagctggttgcggctgtaaa
atttccccaaaagtgttggaaaccatcctgcacagtgagcaggcgaagtttgttgatccg
aatttgcttgtgggtaatgaaacccgcgacgatgcggcggtgtacgatctgggcaatggc
accagcgttatcagtaccaccgacttctttatgccgatcgttgataatcctttcgatttt
ggccgcattgcggcgactaacgccatcagcgatatcttcgcgatggggggcaaaccgatt
atggcgattgcgatcctcggctggccgattaacaaactttccccggaaattgcccgcgaa
gtgaccgaaggtggacgctatgcatgtcgtcaggcgggtattgcgctggctggcggtcac
tccatcgatgcgccggagccgatttttggtctggcggtaacggggatcgtaccgaccgag
cgggtgaagaaaaacagtaccgcacaagccggatgcaaactgttcctgacgaaaccgctg
gggatcggcgttcttaccacggctgagaaaaaatcactgttgaaaccagaacatcaggga
ctggcgacggaagtgatgtgccggatgaacatcgcaggcgcgtcctttgccaacatcgaa
ggcgtaaaagcgatgaccgacgttacgggctttggtctgctgggccacttgagcgaaatg
tgtcagggggctggtgtgcaggcacgcgtcgactatgaagcgatcccgaaactccccggt
gttgaagagtacattaagttgggcgcagtacctggcggcactgaacgtaactttgccagc
tacggtcatctgatgggtgaaatgccgcgtgaagtgcgcgatctgctgtgcgatccgcaa
acttctggcggtttgctgctggcggtcatgccggaagcagaaaatgaggtcaaagctaca
gccgccgagtttggcattgaactgacggcaattggcgaactggtgccagcgcgcggcggt
cgtgccatggttgagattcgttaa

DBGET integrated database retrieval system