KEGG   Escherichia coli O9 HS (commensal): EcHS_A2387
Entry
EcHS_A2387        CDS       T00591                                 

Definition
(GenBank) HpcH/HpaI aldolase/citrate lyase family protein
  KO
K12660  2-dehydro-3-deoxy-L-rhamnonate aldolase [EC:4.1.2.53]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00051  Fructose and mannose metabolism
ecx01100  Metabolic pathways
ecx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EcHS_A2387
Enzymes [BR:ecx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.53  2-keto-3-deoxy-L-rhamnonate aldolase
     EcHS_A2387
SSDB
Motif
Pfam: HpcH_HpaI PK
Other DBs
NCBI-ProteinID: ABV06665
UniProt: A8A2B1
Structure
PDB: 
2VWS 2VWT

Position
complement(2398829..2399632)
AA seq 267 aa
MNALLSNPFKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQ
LQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPYGER
GVGASVARAARWGRIENYMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADL
SASLGYPDNAGHPEVQRIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDT
MLYSDALDQRLAMFKSGKNGPRIKGSY
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaacgcattattaagcaatccctttaaagaacgtttacgcaagggcgaagtgcaaatt
ggtctgtggttaagctcaacgactgcctatatggcagaaattgccgccacttctggttat
gactggttgctgattgacggggagcacgcgccaaacaccattcaggatctttatcatcag
ctacaggcggtagcgccctatgccagccaacccgtgatccgtccggtggaaggcagtaaa
ccgctgattaaacaagtcctggatattggcgcgcaaactctactgatcccgatggtcgat
actgccgaacaggcacgtcaggtggtgtctgccacgcgctatcctccctacggtgagcgt
ggtgtcggggccagtgtggcacgggctgcgcgctggggacgcattgagaattacatggcg
caagttaacgattcgctttgtctgttggtgcaggtggaaagtaaaacggcactggataac
ctggacgaaatcctcgacgtcgaagggattgatggcgtgtttattggacctgcggatctt
tctgcgtcgttgggctacccggataacgccgggcacccggaagtgcagcgaattattgaa
accagtattcggcggatccgtgctgcgggtaaagcggctggttttctggctgtggctcct
gatatggcgcagcaatgcctggcgtggggagcgaactttgtcgctgttggcgttgacacg
atgctctacagcgatgccctggatcaacgactggcgatgtttaaatcaggcaaaaatggg
ccacgcataaaaggtagttattga

DBGET integrated database retrieval system