KEGG   Escherichia coli O9 HS (commensal): EcHS_A2525Help
Entry
EcHS_A2525        CDS       T00591                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00010  Glycolysis / Gluconeogenesis
ecx00052  Galactose metabolism
ecx00500  Starch and sucrose metabolism
ecx00520  Amino sugar and nucleotide sugar metabolism
ecx00521  Streptomycin biosynthesis
ecx01100  Metabolic pathways
ecx01110  Biosynthesis of secondary metabolites
ecx01120  Microbial metabolism in diverse environments
ecx01130  Biosynthesis of antibiotics
ecx01200  Carbon metabolism
Module
ecx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcHS_A2525 (glk)
   00052 Galactose metabolism
    EcHS_A2525 (glk)
   00500 Starch and sucrose metabolism
    EcHS_A2525 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    EcHS_A2525 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EcHS_A2525 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    EcHS_A2525 (glk)
Enzymes [BR:ecx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EcHS_A2525 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: ABV06796
UniProt: A8A2P2
Structure
PDB: 

Position
complement(2539863..2540828)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccaattaccggtgactgggtggcgatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttaccgctgtatcgatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtcgaaggtaagcctattgcggtttacggtgccggaacggggcttggg
gttgcgcatctggtccatgtcgataagcgttgggtaagcttgccaggcgaaggcggtcac
gttgattttgcgccgaatagtgaagaagaggccattatcctcgaaatattgcgtgcggaa
attggtcatgtttcggcggagcgcgtgctttctggccctgggctggtgaatttgtatcgc
gcaattgtgaaagctgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgcgcgctggctgacagctgcaccgattgccgccgcgcattgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcgctcaatctcgggacatttggcggcgtgtttatt
gcgggcggtatcgtgccgcgcttccttgagttcttcaaagcctccggtttccgtgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
catgacaatccgggccttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctgtaa

DBGET integrated database retrieval system