KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_0024Help
Entry
ECSE_0024         CDS       T00784                                 

Definition
(GenBank) isoleucyl-tRNA synthase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00970  Aminoacyl-tRNA biosynthesis
Module
ecy_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ECSE_0024
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecy01007]
    ECSE_0024
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ecy03016]
    ECSE_0024
Enzymes [BR:ecy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     ECSE_0024
Amino acid related enzymes [BR:ecy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ECSE_0024
Transfer RNA biogenesis [BR:ecy03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ECSE_0024
 Prokaryotic Type
   Other AARSs
    ECSE_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g zf-FPG_IleRS tRNA-synt_1e tRNA-synt_1_2 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: BAG75548
UniProt: B6HZ21
Position
24338..27154
Genome map
AA seq 938 aa AA seqDB search
MSDYKSTLNLPETGFPMRGDLAKREPGMLARWTDDDLYGIIRAAKKGKKTFILHDGPPYA
NGSIHIGHSVNKILKDIIVKSKGLSGYDSPYVPGWDCHGLPIELKVEQEYGKPGEKFTAA
EFRAKCREYAATQVDGQRKDFIRLGVLGDWSHPYLTMDFKTEANIIRALGKIIGNGHLHK
GAKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFQAVDQDALKAKFAVSNVNGPISLVIW
TTTPWTLPANRAISIAPDFDYALVQIDGQAVILAKDLVESVMQRIGVTDYTILGTVKGAE
LELLRFTHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGPDDYVIGQKYGLETANPVGPD
GTYLPGTYPTLDGVNVFKANDIVVALLQEKGALLHVEKMQHSYPCCWRHKTPIIFRATPQ
WFVSMDQKGLRAQSLKEIKGVQWIPDWGQARIESMVANRPDWCISRQRTWGVPMSLFVHK
DTEELHPRTLELMEEVAKRVEVDGIQAWWDLDAKEILGDEADQYVKVPDTLDVWFDSGST
HSSVVDVRPEFAGHAADMYLEGSDQHRGWFMSSLMISTAMKGKAPYRQVLTHGFTVDGQG
RKMSKSIGNTVSPQDVMNKLGADILRLWVASTDYTGEMAVSDEILKRAADSYRRIRNTAR
FLLANLNGFDPAKDMVKPEEMVVLDRWAVGCAKAAQEDILKAYEAYDFHEVVQRLMRFCS
VEMGSFYLDIIKDRQYTAKADSVARRSCQTALYHIAEALVRWMAPILSFTADEVWGYLPG
EREKYVFTGEWYEGLFGLADSEAMNDAFWDELLKVRGEVNKVIEQARADKKVGGSLEAAV
TLYAEPELSAKLTALGDELRFVLLTSGATVADYNDAPADAQQSEVLKGLKVALSKAEGEK
CPRCWHYTQDVGKVAEHAEICGRCVSNVAGDGEKRKFA
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactataaatcaaccctgaatttgccggaaacagggttcccgatgcgtggcgat
ctcgccaagcgcgaaccgggaatgctggcgcgttggactgatgatgatctgtacggcatc
atccgtgcggctaaaaaaggcaaaaaaaccttcattctgcatgatggccctccttatgcg
aatggcagcattcatattggtcactcggttaacaagattctgaaagacattatcgtgaag
tccaaagggctttccggttatgactcgccgtatgtgcctggctgggactgccacggtctg
ccgatcgagctgaaagtagagcaagaatacggtaagccgggtgagaaattcaccgccgcc
gagttccgcgccaagtgccgcgaatacgcggcgacccaggttgacggtcaacgcaaagac
tttatccgtctgggcgtgctgggcgactggtcgcacccgtacctgaccatggacttcaaa
actgaagccaacatcatccgcgcgctgggcaaaatcatcggcaacggtcacctgcacaaa
ggcgcgaagccagttcactggtgcgttgactgccgttctgcgctggcggaagcggaagtt
gagtattacgacaaaacttctccgtccatcgacgttgcttttcaggcggtcgatcaggat
gcactgaaagcaaaatttgccgtaagcaacgttaacggcccaatctcgctggtgatctgg
accactacgccgtggactctgcctgcgaaccgcgcaatctctattgcacctgatttcgac
tatgcgctggtgcagatcgacggtcaggccgtgattctggcgaaagatctggttgaaagc
gtaatgcagcgtatcggcgtgaccgattacaccattctcggcacggtaaaaggtgcggag
cttgagttgctgcgctttacccatccgtttatgggcttcgacgttccggcaatcctcggc
gatcacgttaccctggatgccggtaccggtgccgttcacaccgcgcctggccacggcccg
gacgactatgtgatcggtcagaaatacggcctggaaaccgctaacccggttggcccggac
ggcacttatctgccgggcacttatccgacgctggatggcgtgaacgtcttcaaagcgaac
gacatcgtcgttgcgctgctgcaggaaaaaggcgcgctgctgcacgttgagaaaatgcag
cacagctatccgtgctgctggcgtcacaaaacgccgatcatcttccgcgcgacgccgcag
tggttcgtcagcatggatcagaaaggtctgcgtgcgcagtcactgaaagagatcaaaggc
gtgcagtggatcccggactggggccaggcgcgtatcgagtcgatggttgctaaccgtcct
gactggtgtatctcccgtcagcgcacctggggcgtaccgatgtcactgttcgtgcacaaa
gacacggaagagctgcatccgcgtactctcgaactaatggaagaagtggcaaaacgcgtt
gaagttgacggcatccaggcgtggtgggatcttgatgcgaaagagatcctcggcgatgaa
gctgatcagtacgtgaaagtgccggacacattggatgtatggtttgactccggatctacc
cactcttctgttgttgacgtgcgtccggaatttgccggtcacgcagcggacatgtatctg
gaaggttctgaccagcaccgtggttggttcatgtcttccctgatgatctccaccgcgatg
aaaggcaaagcgccgtatcgtcaggtactgacccacggctttaccgtggatggtcagggt
cgcaagatgtctaaatccatcggcaataccgtttcgccgcaggatgtgatgaacaaactg
ggcgcggatattctgcgtctgtgggtggcatcaaccgactacaccggtgaaatggccgtt
tctgacgagatcctgaaacgtgctgccgatagctatcgtcgtatccgtaacaccgcgcgc
ttcctgctggcaaacctgaacggttttgatccagcaaaagatatggtgaaaccggaagag
atggtggtactggatcgctgggccgtaggttgtgcgaaagcggcacaggaagacatcctc
aaggcgtacgaagcatacgatttccacgaagtggtacagcgtctgatgcgcttctgctcc
gttgagatgggttccttctacctcgacatcatcaaagaccgtcagtacaccgccaaagcg
gacagtgtggcgcgtcgtagctgccagactgcgctgtatcacatcgcagaagcgctggtg
cgctggatggcaccaatcctctccttcaccgctgatgaagtgtggggctacctgccgggc
gaacgtgaaaaatacgtcttcaccggtgagtggtacgaaggcctgtttggcctggcagac
agtgaagcgatgaacgatgcgttctgggacgagctgttgaaagtgcgtggcgaagtgaac
aaagtcattgagcaagcgcgtgccgacaagaaagtgggtggctcgctggaagcggcagta
accttgtatgcagaaccggaactgtcggcgaaactgaccgcgctgggcgatgaattacga
tttgtcctgttgacctccggcgctaccgttgcagactataacgacgcacctgctgatgct
cagcagagcgaagtactcaaagggctgaaagtcgcgttgagtaaagccgaaggtgagaag
tgcccacgctgctggcactacacccaggatgtcggcaaggtggcggaacacgcagaaatc
tgcggccgctgtgtcagcaacgtcgccggtgacggtgaaaaacgtaagtttgcctga

DBGET integrated database retrieval system