KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_0216Help
Entry
ECSE_0216         CDS       T00784                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECSE_0216
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecy02044]
    ECSE_0216
Secretion system [BR:ecy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECSE_0216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C HAD AAA_22 AAA_16
Motif
Other DBs
NCBI-ProteinID: BAG75740
UniProt: B6HZT3
Position
complement(243552..247076)
Genome map
AA seq 1174 aa AA seqDB search
MFRLPTPRLLSGLKSALRPAMPRFKVSAFWLLILAWIFLLVWIWWKGPTWTLYEEQWLKP
LANRWLATAAWGIIALMWLTVRVMKRLQQLEKMQKQQREEAVDPLSVELNAQQRYLDRWL
LRLQRHLDNRRFLWQLPWYMVIGPAGSGKTTLLREGFPSDIIYAPEGARGAEQRLYLTPH
VGKQAVIFDIDGTLCAPADADILHRRLWEHALGWLKEKRARQPLNGIILTLDLPDLLTAD
KRRREHLLQALRSRLQDIRQHLHCQLPVYVVLTRLDLLQGFAALFQSLNRQDRDAILGVT
FTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVAQTHTRASLFSFSRQMQGSREPLVS
LLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYF
TRSLFPQALLAEPNLATESRAWLIRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGI
TVLKQAKAFMDVPPPQGEDDFGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIG
PYVEQTYLQLLEQRYLPSLFNGLVKALNAAPPESEEKLAVLRVMRMLEDKSGRNNQVVKQ
YMAKRWSEKFHGQRDIQAQLMSHLDYALAHTDWHAERQAGDGDAISRWTPYDKPVVSAQK
ELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQVFTSADDNKLVVPQFLTRYGL
QSYFVKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDYTATWRAGMDN
LNIRNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKEREEALAEPDY
QLLTRLGHEFAPENSTLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQL
RLDQNSSDPIFATRQMAKTLPAPLNRWVGRLTDQAWHVVMVEAVHYMEVDWRDSVVKPFN
EQLANNYPFNPRSAQDASLDAFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNNVIIR
EDIIAQLETAQKIRDIFFSKQNGLGTSFAVETVSLSGNKRRSVLNLDGQLVDYSQGRNYT
AHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFRLFGAGQLTGVQDGNFTVRFS
VDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
gtgttcagattaccaacaccccgactactcagcggactcaaatcagccctgcgaccggcg
atgccccggtttaaagtctctgctttctggctgctgatactggcgtggatttttctgctg
gtgtggatctggtggaaaggcccgacgtggacgctgtatgaagaacagtggctcaaacca
ctggcgaaccgctggctggcaacggcggcgtgggggattattgccctgatgtggcttacc
gtccgggtgatgaagcgcctgcaacagcttgaaaaaatgcaaaagcaacagcgcgaggaa
gccgttgatccgctcagcgtggaactgaacgcccagcagcgttatcttgaccgctggctg
ctgcgcctgcaacgccatctcgacaaccgccgtttcctgtggcagttgccgtggtatatg
gtcatcggcccggcgggcagtggcaaaacgacactgctgcgcgaggggtttccgtccgac
attatttatgccccggagggcgcacgcggcgcagaacaacgcctgtacctcacgccccat
gtcggtaaacaggcggtgatctttgatatcgacggcacactctgcgctcccgctgatgcg
gatatcctgcatcgccgtctgtgggaacatgccctcggctggctgaaagaaaagcgcgcg
cgccagccgctgaatgggattattctgacactcgatttacccgatctgcttaccgcagac
aaacgccgccgcgagcatctgttacaggcgctgcgcagccgcttgcaggatatacgccag
catcttcactgccagttaccggtttacgtggtacttacccggcttgatttattgcagggt
tttgccgccctgtttcagtccctgaacagacaggatcgcgatgcgattctgggcgtcacg
ttcacccgccgtgcccatgaaaatgatgactggcgaacagagttgaatgctttctggcag
acatgggtggatcgaatgaatctggcgttgccggatctgatggtcgctcagactcacacc
cgcgcgtctttattcagtttttcccgccagatgcagggaagccgtgaaccgctggtgtca
ctgcttgagggtctgcttgatggcgaaaatatgaacgtgatgctgcgtggtgtctatctc
acctcttcgcttcagcgtggacagatggatgatatattcacccagtctgccgcccgccag
taccggctgggcaataacccactggcgtcctggcccctggtggacaccgcgccttatttc
acccgcagcctgttcccgcaggcattactcgcagagcctaatctggcaacagagagccgc
gcctggctgatacgttcccgtcgccgcctgacggttttctctgccacaggcggcgtggca
gcactgctgctcatcaccggctggcatcactattacaacggtaactatcagtctggcatc
accgtgcttaagcaggccaaagcctttatggacgtgccgcctccgcagggggaagatgac
tttggcaacctgcaactgccgctcctgaacccggtacgcgatgccacactggcctatggc
gactggggcgaccgcagccgtctggccgatatgggactgtaccagggacgacgtatcggg
ccttatgtggaacagacctatctgcaactgctggagcaacgttacctgccctcgctgttt
aacgggctggtcaaagcgctgaacgccgcgccgccggagagtgaagaaaaactcgcggtg
ctgcgcgtgatgcgaatgctggaggacaaaagcggacgtaacaatcaggtggtgaagcag
tatatggcaaaacgctggagcgaaaagttccacggtcagcgcgatatccaggcacaactg
atgtcccatcttgactacgcgctggctcatactgactggcacgcagagcgtcaggcgggc
gacggtgacgccatcagccgctggacgccatatgacaagcccgtggtatcagcacagaaa
gaactgagcaaactgcctgtctaccagcgggtttaccagagcctgaaaacgcgggcgctg
ggcgttcttcctgccgacctcaatctgcgtgaccaggtagggccaacctttgaccaggtg
tttacatctgccgatgacaacaaactggttgttccacagtttcttacccgttacggcctg
caaagctattttgtaaaacagcgcgatgaactggttgaactgacggcgatggattcctgg
gtacttaaccttacccgcagcgtgaaatacagtgacgccgaccgcgcggaaatccagcgc
cagttgaccgagcagtatatcagcgactacaccgccacctggcgggccgggatggacaat
ctgaatatccgcaattttgagtccatcggacaactgaccggggcgctggagcaggttatc
agcggcgaccagcctttgcagcgggcgctgaccgtgctgcgtgacaacacacagccaggc
gtcttttctgaaaaactctctgccaaagaacgggaggaagccctggcagagccggattac
cagttactcacccgcctcgggcatgaattcgccccggaaaacagtaccctggcagtacag
aaagacaaagaaagcacgatgcaggccgtgtatcagcaactcaccgagttgcaccgctac
ctgctggcaatccagaacgcgcctgtaccagggaaatcggcgctgaaagccgtgcagtta
cggcttgatcagaacagcagcgatccgatattcgccacccgccagatggcaaaaacgctg
cctgctccgctcaaccgctgggttggcagactgactgaccaggcctggcatgtggtgatg
gtggaggctgttcattatatggaagtggactggcgcgacagcgtggtgaaaccgtttaac
gagcaactggcaaataactatccgtttaatccgcgttctgcacaggatgcctcactggat
gccttcgaacgcttctttaaaccggatggcatactggataccttctaccagcagaacctg
aagctgtttatcgataatgacctgagtctggaggatggcgataacaacgtcattattcgc
gaagatattattgcgcaactggaaactgcgcagaaaatccgtgacatcttcttcagcaaa
cagaacggtctgggaacatcctttgccgtggaaacggtatcgctttcaggcaataaacgc
cgcagtgtactgaaccttgacggtcagttagtcgattacagccagggccgtaactatacc
gcccatctggtctggcctaacaacatgcgcgaaggcaacgaaagtaagctgacgctcatc
ggcaccagcggcaacgcgccgcgcagtatcagcttcagcgggccgtgggcgcagttccgc
ctgttcggggccggacaactgaccggagtacaggatggcaactttaccgtgcgctttagc
gtggacggtggcgcgatgacctaccgtgtgcataccgacacggaagataacccgttcagc
ggtgggttgttcagccagtttggtctgtcagacacactgtactga

DBGET integrated database retrieval system