KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_0222
Entry
ECSE_0222         CDS       T00784                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECSE_0222
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecy02044]
    ECSE_0222
Secretion system [BR:ecy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECSE_0222
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: BAG75746
UniProt: B6HZT9
Position
complement(254324..254848)
AA seq 174 aa
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNA
EGESAAVDVQLVYLTDDSKLLAADYDQIASTPLQDVLGKNYIDHQDFNLLPDTIKTLPPV
KLDEKTQFIGVVAYFSDDQATEWKQIETVEGTGHHYRLLVHVRQSSIEMKKEDE
NT seq 525 nt   +upstreamnt  +downstreamnt
atgaacaggaaggcgtttctggcctgcgtgctgatgtgcgtcatattaaccggctgcgaa
acggcgaaaaaaatcagtgaggtgatcaaaaacccggatatccaggtcgggagcctgaag
gagcaaccttcggaaataaccgtcaccctgctgaccgaaccggacaccaataccaatgcg
gaaggtgaatcagccgccgtggatgtgcaactggtgtacctgactgacgactcaaaattg
ctggcagccgactatgaccagatagccagtacgccgctacaggatgtgctgggtaaaaac
tatatcgaccaccaggatttcaacctgttgccggacaccatcaaaaccctgccgccggta
aagctggatgagaaaacgcagtttattggtgtcgtggcctatttctccgatgaccaggcc
actgaatggaaacaaatcgagacggtggaaggaaccggccaccattaccgcctgctggtg
catgtacgtcaaagcagcatcgaaatgaaaaaagaggatgaataa

DBGET integrated database retrieval system