KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_0229
Entry
ECSE_0229         CDS       T00784                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecy02044]
    ECSE_0229
Secretion system [BR:ecy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECSE_0229
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: BAG75753
UniProt: B6HZU6
Position
complement(261255..261755)
AA seq 166 aa
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSPLDERQAVSVN
KHNFGAVMAEAAIGLNFTVPATLKGSTTDDELNVALNIKSLDDFSPDSVARQVPEVNKLL
ELREALTALKGPMGNLPAFRTQLQALLENEESREQLLKEIGQVSNK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagcaaaaaatttgaaggcagcgtcgcgcctcgcgagcgtattaatatatcgtatgtc
ccaaaaacagatggccagacggctgaagtggaacttccgcttaacatgctcgttgtcggc
gataccggaaatacgcaggaaacatccccactggatgaacgtcaggcagtttccgttaac
aagcacaatttcggtgcagtgatggctgaagcagccattggcctcaattttactgtcccc
gccacgctgaagggaagcacaacagacgatgaactgaatgtggcgctgaatatcaaatca
ctggatgatttttcaccagatagcgtggcccggcaggttccggaagtgaataaattgctg
gaactgcgtgaagcactgactgcactgaaggggccgatgggtaaccttccggcattccgt
acccagctccaggcattgctggaaaatgaagagtcccgcgagcagttgctcaaagaaatc
ggccaggtgagcaataaataa

DBGET integrated database retrieval system