KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_1289Help
Entry
ECSE_1289         CDS       T00784                                 

Definition
(GenBank) aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00010  Glycolysis / Gluconeogenesis
ecy00071  Fatty acid degradation
ecy00350  Tyrosine metabolism
ecy00620  Pyruvate metabolism
ecy00625  Chloroalkane and chloroalkene degradation
ecy00626  Naphthalene degradation
ecy00650  Butanoate metabolism
ecy01100  Metabolic pathways
ecy01110  Biosynthesis of secondary metabolites
ecy01120  Microbial metabolism in diverse environments
ecy01130  Biosynthesis of antibiotics
ecy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ecy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECSE_1289
   00620 Pyruvate metabolism
    ECSE_1289
   00650 Butanoate metabolism
    ECSE_1289
  Lipid metabolism
   00071 Fatty acid degradation
    ECSE_1289
  Amino acid metabolism
   00350 Tyrosine metabolism
    ECSE_1289
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECSE_1289
   00626 Naphthalene degradation
    ECSE_1289
Enzymes [BR:ecy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ECSE_1289
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ECSE_1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: BAG76813
UniProt: B6I9V4
Position
complement(1361750..1364425)
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFATHGGYLLQGKELKAVQDVILKNGALNAAIVGQP
AYKIAELAGFSVPENTKILIGEVTVVDESEPFAHEKLSPTLAMYRAKDFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQPARVSYFGQKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSIVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHAME
AYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLETLKAELGIPKSIREAGVQEADFLANVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRDYVEGETAAKKEAAPAKAEKKAKKSA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagagcgtgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagagcaagtagacaaaatcttccgcgccgccgctctg
gctgctgcagatgctcgaatcccactcgcgaaaatggccgttgccgaatccggcatgggt
atcgtcgaagataaagtgatcaaaaaccactttgcttctgaatatatctacaacgcctat
aaagatgaaaaaacctgtggtgttctgtctgaagacgacacttttggtaccatcactatc
gctgaaccaatcggtattatttgcggtatcgttccgaccactaacccgacttcaactgct
atcttcaaatcgctgatcagtctgaagacccgtaacgccattatcttctccccgcacccg
cgtgcaaaagatgccaccaacaaagcggctgatatcgttctgcaggctgctatcgctgcc
ggtgctccgaaagatctgatcggctggatcgatcaaccttctgttgaactgtctaacgca
ctgatgcaccacccagacatcaacctgatcctcgcgactggtggtccgggcatggttaaa
gccgcatacagctccggtaaaccagctatcggtgtaggcgcgggcaacactccagttgtt
atcgatgaaactgctgatatcaaacgtgcagttgcatctgtactgatgtccaaaaccttc
gacaacggcgtaatctgtgcttctgaacagtctgttgttgttgttgactctgtttatgac
gctgtacgtgaacgttttgcaacccacggcggctatctgttgcagggtaaagagctgaaa
gctgttcaggatgttatcctgaaaaacggtgcgctgaacgcggctatcgttggtcagcca
gcctataaaattgctgaactggcaggcttctctgtaccagaaaacaccaagattctgatc
ggtgaagtgaccgttgttgatgaaagcgaaccgttcgcacatgaaaaactgtccccgact
ctggcaatgtaccgcgctaaagatttcgaagacgcggtagaaaaagcagagaaactggtt
gctatgggcggtatcggtcatacctcttgcctgtacactgaccaggataaccaaccggct
cgcgtttcttacttcggtcagaaaatgaaaacggctcgtatcctgattaacaccccagcg
tctcagggtggtatcggtgacctgtataacttcaaactcgcaccttccctgactctgggt
tgtggttcttggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgccgtggctccctgccaatcgcgctggatgaagtgattactgatggccacaaa
cgtgcgctcatcgtgactgaccgcttcctgttcaacaatggttatgctgatcagatcact
tccgtactgaaagcagcaggcgttgaaactgaagtcttcttcgaagtagaagcggacccg
accctgagcatcgttcgtaaaggtgcagaactggcaaactccttcaaaccagacgtgatt
atcgcgctgggtggtggttccccgatggacgccgcgaagatcatgtgggttatgtacgaa
catccggaaactcacttcgaagagctggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgctgtcaccaccacttctggt
acaggttctgaagtcactccgtttgcggttgtaactgacgacgctactggtcagaaatat
ccgctggcagactatgcgctgactccggatatggcgattgtcgacgccaacctggttatg
gacatgccgaagtccctgtgtgctttcggtggtctggacgcagtaactcacgccatggaa
gcttatgtttctgtactggcatctgagttctctgatggtcaggctctgcaggcactgaaa
ctgctgaaagaatatctgccagcgtcctaccacgaagggtctaaaaatccggtagcgcgt
gaacgtgttcacagtgcagcgactatcgcgggtatcgcgtttgcgaacgccttcctgggt
gtatgtcactcaatggcgcacaaactgggttcccagttccatattccgcacggtctggca
aacgccctgctgatttgtaacgttattcgctacaatgcgaacgacaacccgaccaagcag
actgcattcagccagtatgaccgtccgcaggctcgccgtcgttatgctgaaattgccgac
cacctgggtctgagcgcaccgggcgaccgtactgctgctaagatcgagaaactgctggca
tggctggaaacgctgaaagctgaactgggtattccgaaatctatccgtgaagctggcgtt
caggaagcagacttcctggcgaacgtggataaactgtctgaagatgcgttcgatgaccag
tgcaccggcgctaacccgcgttacccgctgatctccgagctgaaacagatcctgctggat
acctactacggtcgtgattatgtagaaggtgaaactgcagcgaaaaaagaagccgctccg
gctaaagctgagaaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system