KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_3093Help
Entry
ECSE_3093         CDS       T00784                                 

Definition
(GenBank) 2-acyl-glycerophospho-ethanolamine acyltransferase
  KO
K05939  acyl-[acyl-carrier-protein]-phospholipid O-acyltransferase / long-chain-fatty-acid--[acyl-carrier-protein] ligase [EC:2.3.1.40 6.2.1.20]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00071  Fatty acid degradation
ecy00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECSE_3093
   00564 Glycerophospholipid metabolism
    ECSE_3093
Enzymes [BR:ecy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.40  acyl-[acyl-carrier-protein]---phospholipid O-acyltransferase
     ECSE_3093
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.20  long-chain-fatty-acid---[acyl-carrier-protein] ligase
     ECSE_3093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Acyltransferase AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAG78617
UniProt: B6I6W1
Position
complement(3212629..3214788)
Genome map
AA seq 719 aa AA seqDB search
MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLGLFLPVRPVFAVYTS
ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG
AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVEMPDAPRARD
RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK
TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA
AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV
KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG
LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR
LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM
DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR
FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT
TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgctttttagcttttttcgaaatttgtgccgtgttttgtatcgcgttcgcgttacgggt
gacacccaggcactgaagggcgagcgcgttctaattacgcctaatcacgtctcttttatt
gatggcattttgcttggactgtttttacctgtgcgtccagtgtttgccgtttacacctca
ataagccaacagtggtatatgcgttggctgaaatcatttatcgactttgttcctctcgac
ccgacgcaacctatggctattaaacatctggtacgtctggtggaacagggccgaccagtg
gtgattttccctgaaggacgcatcaccactacaggctcgctgatgaaaatctacgatggc
gcgggttttgtcgcggcgaagtctggtgcaacggttattcctgtgcgtattgaaggggcg
gaacttacgcacttcagccgcctgaaaggtctggttaaacgtcgcttgttcccgcaaatt
actctgcatattttgccaccaacgcaggtggagatgccggatgcgccgcgtgcccgtgac
cgtcgcaaaatcgctggcgaaatgctgcatcaaataatgatggaagcgcgaatggcggtg
cgcccgcgtgaaacgctgtacgaatctttactgagtgcaatgtaccgcttcggagccggg
aagaaatgtgtcgaagacgtcaattttaccccagactcctatcgcaaattgcttacgaaa
acgctgtttgttggacgcatccttgaaaaatacagtgtcgaaggcgaacgcatcggctta
atgctgcccaatgcaggcatcagtgcggcagtgatttttggggccatcgcccgtcgccgc
attcccgcaatgatgaactacactgctggggtaaaggggctgaccagtgctattacggcg
gctgaaatcaaaaccatcttcacttcccgccagtttctcgataaaggcaaactctggcat
ctgccggagcaacttactcaggtgcgctgggtctatctggaagatttaaaagcagatgtc
accactgccgacaaagtatggatcttcgctcatttgctgatgccgcgtctggcacaggtt
aaacagcagccggaagaagaggcgctgatcctttttacctccggttctgaaggccatccg
aaaggcgtcgtccatagccataaaagcattctggcgaacgtcgagcagattaaaacgatt
gccgacttcaccaccaacgatcgctttatgtcggcgttaccgctgtttcactcctttggg
ctgacggtaggcctgtttacgccactgctcacaggtgcagaagtgtttctttatccaagc
ccgctgcattaccgtattgtgccggagttggtgtatgaccgcagttgcaccgtgttgttc
ggcacctcgactttcctcggtcactacgcgcgtttcgccaacccgtatgacttctatcgt
ctacgctatgtggtggcaggcgcagaaaaattacaagaaagtaccaaacagctttggcag
gataaatttggcctgcgcatccttgaaggctacggcgtgaccgaatgcgcgcctgtcgtt
tctatcaacgtaccgatggcggcgaaacccggtacggtagggcgtattctaccaggaatg
gatgcgcgcctgttgtcggtccctggtatcgaagagggcggacgcctgcaactgaaaggg
ccgaacataatgaacggctatctgcgggtggagaagccaggtgtactggaagtgcccacc
gccgagaatgttcgcggcgaaatggagcgcggctggtatgacactggcgatattgtgcgt
tttgacgagcagggctttgtgcagattcagggccgcgcaaaacgctttgccaaaattgca
ggcgaaatggtgtcgctggaaatggtggaacaactggcacttggtgtttcgccagataaa
gtccatgccactgcgattaagagcgatgccagcaaaggcgaggcactggtgcttttcacc
acagataacgaactgacgcgcgataagttgcaacagtatgcccgcgagcacggcgtgccg
gagcttgctgtaccgcgcgatattcgctatctgaaacagatgccattacttggcagcggc
aaacctgactttgtcacgttgaaaagctgggtagacgaagcggaacaacacgatgagtga

DBGET integrated database retrieval system