KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_3132
Entry
ECSE_3132         CDS       T00784                                 

Definition
(GenBank) putative dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00230  Purine metabolism
ecy01100  Metabolic pathways
ecy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECSE_3132
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: BAG78656
UniProt: B6I702
Position
3249215..3249694
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVQDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggctggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttcaggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system