KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_4233Help
Entry
ECSE_4233         CDS       T00784                                 

Definition
(GenBank) cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00270  Cysteine and methionine metabolism
ecy00450  Selenocompound metabolism
ecy00920  Sulfur metabolism
ecy01100  Metabolic pathways
ecy01110  Biosynthesis of secondary metabolites
ecy01130  Biosynthesis of antibiotics
ecy01230  Biosynthesis of amino acids
Module
ecy_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ECSE_4233
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECSE_4233
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECSE_4233
Enzymes [BR:ecy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     ECSE_4233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: BAG79757
UniProt: B6I4T7
Structure
PDB: 

Position
4395502..4396662
Genome map
AA seq 386 aa AA seqDB search
MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA
LAELEGGAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVL
FVDQGDEQALRAALAEKPKLVLVESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPA
LQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYL
LLRGLRTLVPRMELAQRNAQAIVKYLQSQPLVKKLYHPSLPENQGHEIAARQQKGYGAML
SFELDGDEQTLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLL
RISTGIEDGEDLIADLENGFRAANKG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtaaacaggccaccatcgcagtgcgtagcgggttaaatgacgacgaacagtat
ggttgcgttgtcccaccgatccatctttccagcacatataactttaccggatttaatgaa
ccgcgcgcgcatgattactcgcgtcgcggcaacccaacgcgcgatgtggttcagcgtgcg
ctggcagaactggaaggcggtgctggtgcagtacttactaataccggcatgtccgcgatt
cacctggtaacgaccgtctttttgaaacctggcgatctgctggttgcgccgcacgactgc
tacggcggtagctatcgcctgttcgacagcctggcgaaacgcggttgctatcgcgtgttg
tttgttgatcaaggcgatgaacaggcattacgggcagcgctggcagaaaaacccaaactg
gtactggtagaaagcccaagtaatccattgttacgcgtcgtggatattgcgaaaatctgc
catctggcaagggaagtcggggcggtgagcgtggtggataacaccttcttaagcccggca
ttacaaaatccgctggcattaggtgccgatctggtgttgcattcatgcacgaaatatctg
aacggtcactcagacgtggtggctggcgtggtgattgctaaagatccggacgttgtcacc
gaactggcctggtgggcaaacaatattggcgtgacgggcggcgcgtttgacagctatctg
ctgctacgcgggttgcgaactctggtgccgcgtatggagctggcgcagcgcaacgcgcag
gcgattgtgaaatatctgcaaagccagccgttggtgaaaaaactgtatcacccgtcgctg
ccggaaaatcaggggcatgaaattgccgcgcgccagcaaaaaggctatggcgcaatgttg
agttttgaactggatggcgatgagcagacgctgcgtcgtttcctgggtggactgtcgttg
tttacgctggcggaatcattagggggagtggaaagtttaatctctcacgccgcaaccatg
acacatgcaggcatggcaccagaagcgcgtgctgccgccgggatctccgagacgctgctg
cgtatctccaccggtattgaagatggcgaagatttaattgccgacctggaaaatggcttc
cgggctgcaaacaaggggtaa

DBGET integrated database retrieval system