KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_4299Help
Entry
ECSE_4299         CDS       T00784                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00620  Pyruvate metabolism
ecy00630  Glyoxylate and dicarboxylate metabolism
ecy01100  Metabolic pathways
ecy01110  Biosynthesis of secondary metabolites
ecy01120  Microbial metabolism in diverse environments
ecy01200  Carbon metabolism
Module
ecy_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECSE_4299
   00630 Glyoxylate and dicarboxylate metabolism
    ECSE_4299
Enzymes [BR:ecy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ECSE_4299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: BAG79823
UniProt: B6I5M2
Structure
PDB: 

Position
4484877..4486478
Genome map
AA seq 533 aa AA seqDB search
MTEQATTTDELAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDN
GTLPDFISETASIRDADWKVRGIPADLEDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQA
VTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEERNNQVLNKVKADKSLEANNG
HDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCDGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKALFR
QMLDEEMKVIASELGEERFSQGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaggcaacaacaaccgatgaactggctttcacaaggccgtatggcgaacag
gagaagcaaattcttactgccgaagcggtagaatttctgactgagctggtgacgcatttt
acgccacaacgcaataaacttctggcagcgcgcattcagcagcagcaagatattgataac
ggaacgttgcctgattttatttcggaaacagcttccattcgtgatgctgactggaaagtt
cgcgggattcctgcggacttagaagatcgtcgagtagagataactggcccggtagagcgc
aagatggtgatcaacgcgctcaacgccaatgtgaaagtctttatggccgatttcgaagat
tcactggccccggactggaacaaagtgatcgacgggcaaattaacctgcgtgatgcagtt
aacggcaccatcagctataccaatgaagcaggcaaaatttatcagctcaagcccaatcca
gcggttttgatttgtcgggtacgcggtctgcacttgccggaaaaacatgtcacctggcgt
ggtgaggcaatccccggtagcctgtttgattttgcgctctatttcttccacaactatcag
gcactgttggcaaagggcagcggtccctatttctatttgccgaaaacccagtcctggcag
gaagcggcctggtggagcgaagtcttcagctatgcagaagatcgctttaatctgccgcgc
ggcaccatcaaggcgacgttgctgattgaaacgctgcccgccgtgttccagatggatgaa
atccttcacgcgctgcgtgaccatattgttggtctgaactgcggtcgttgggattacatc
ttcagttatatcaaaacgttgaaaaactatcccgatcgcgtcctgccagacagacaggca
gtgacgatggataaacccttcctgaatgcttactcacgcctgttaatcaaaacctgtcat
aaacgcggtgcttttgcgatgggcggcatggcggcatttattccgagcaaagatgaagag
cgcaataaccaggtgctcaacaaagtaaaagcggataaatcgctggaagccaataacggt
cacgatggcacatggatcgctcacccaggccttgcggacacggcaatggcggtattcaac
gacattctcggctcccgtaaaaatcagcttgaagtgatgcgcgaacaagacgcgccgatt
actgccgatcagctgctggcaccttgtgatggtgaacgcaccgaagaaggtatgcgcgcc
aacattcgcgtggctgtgcagtacatcgaagcatggatatccggcaacggctgtgtgccg
atttatggcctgatggaagatgcggcgacggctgaaatttcccgtacctcaatctggcag
tggatccatcatcaaaaaacgttgagcaatggcaaaccggttaccaaagccttgttccgc
cagatgctggacgaagagatgaaagtcattgctagcgaattgggcgaagaacgtttctcc
caggggcgttttgacgatgccgcacgcttgatggaacagatcaccacttccgatgagtta
atagatttcctgaccctgccaggctaccgcctgttagcgtaa

DBGET integrated database retrieval system