KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_P2-0071
Entry
ECSE_P2-0071      CDS       T00784                                 

Definition
(GenBank) TrbC protein
  KO
K12059  conjugal transfer pilus assembly protein TrbC
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecy02044]
    ECSE_P2-0071
Secretion system [BR:ecy02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ECSE_P2-0071
SSDB
Motif
Pfam: TrbC_Ftype
Other DBs
NCBI-ProteinID: BAG80398
UniProt: B6ICG3
Position
pSE11-2:52166..52771
AA seq 201 aa
MWKIVSVCSIAMTCMLSPGIVCASQDSAAFIESLRDQSDMLRRQATVPEFLQQPAPGKHN
DAWIQSLTRKSQQASARSKKTPRALYFLSFSIPEEGLIRMLPEARALGIPALVNGLIDND
FRKTAEAVFRITREKNTGGVQIDPMQFAKYGITSVPALVVTCGERYDLIRGNIRLKAALE
RVAKEGECAPVAEAILRESER
NT seq 606 nt   +upstreamnt  +downstreamnt
gtgtggaagattgtctctgtctgcagcatagccatgacctgcatgctgtcacccggcatt
gtctgtgcttcgcaggacagtgcggcttttattgagtccctgcgtgaccagagtgatatg
ttgcgccggcaggccactgtaccggagtttctgcagcagccagcacccggaaaacataac
gatgcgtggatacagagtctgacccgaaaatcacagcaggcatccgcccgcagtaagaaa
acaccgcgtgcgctgtattttttgtcgttctccataccggaagaaggtctgattcgcatg
ctgccggaggccagggcgctgggtatccccgcactggttaacggactcatcgacaatgac
ttccggaaaacagcagaggccgtattccgtattacccgggagaaaaataccggcggtgtt
cagatagacccgatgcagtttgcaaaatacggcatcacatccgtgccggcactggtggtg
acctgtggtgaacggtatgacctgattcgcggcaatatccgcctgaaagcggcgctggag
cgggtggcgaaggaaggggaatgtgctccggtggctgaagcgattctcagggagagtgaa
cgatga

DBGET integrated database retrieval system