KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_P2-0073
Entry
ECSE_P2-0073      CDS       T00784                                 
Name
(GenBank) TraF protein
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecy02044]
    ECSE_P2-0073
Secretion system [BR:ecy02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ECSE_P2-0073
SSDB
Motif
Pfam: TraF
Other DBs
NCBI-ProteinID: BAG80400
Position
pSE11-2:54716..55489
AA seq 257 aa
MLYLVATISLLISGQTGAQREPVRTYVDEPIVGWHWYNEPQKQDEEEIPPPATVPLTSLP
PTAQMKVLQRMTEERLNTAILYPTVENFTAYMKMQNFWTSQASRFSAVATKSLLMHPELD
YNLQYSHYNSTVPLQLQADQNRQVAAIRQLASQYGLFFFYRGNDALDGELAKVVQRFSDE
YNVALIPVSMDGARSEALPQTRPDSGQAQRLGVTHLPALFLVEPGAERYQPLAYGFMTQD
DLMKRFLSVATDFAPRS
NT seq 774 nt   +upstreamnt  +downstreamnt
atgctgtatctggttgcgacaataagtctgctgatatccggtcagacaggtgcgcaacgt
gaaccggtccgtacctatgtggacgaaccgatagtgggctggcactggtacaacgaacct
cagaaacaggatgaggaggaaatacctccaccggccactgttcccctgacatctcttcct
ccgacagcacagatgaaggtccttcagcgaatgacagaggagcggctgaataccgccatt
ctctacccgacagtggagaattttacggcctacatgaagatgcagaacttctggaccagt
caggccagtcgcttcagtgccgtggccaccaaatccctgctgatgcatccggaactggat
tacaacctgcagtacagtcactacaacagcacagttccgctgcagctgcaggctgaccag
aaccgtcaggtggctgccattcgtcagctggccagtcagtacgggctgttcttcttttac
cgggggaatgatgcactggatggtgagcttgcaaaggtggtgcagcgtttctctgatgaa
tacaacgttgcactgattccggtcagtatggacggtgcccggagcgaggcactgccgcag
acgcgtcctgacagcgggcaggctcagcggctgggcgtgacgcatctgccggcacttttc
ttggttgaaccgggggcagagcgttaccagccgctggcttatggctttatgacgcaggat
gacctgatgaaacgatttttaagtgtggcgacagattttgcgccacggtcgtga

DBGET integrated database retrieval system