KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_P2-0084Help
Entry
ECSE_P2-0084      CDS       T00784                                 

Definition
(GenBank) TraX protein
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraX
Motif
Other DBs
NCBI-ProteinID: BAG80411
UniProt: B6ICH6
Position
pSE11-2:71350..72102
Genome map
AA seq 250 aa AA seqDB search
MENQECFCKDDVRNPGALPLLSLAPLQRDIIKIVAFLAMTGDHIATAFHVGTPWLNLTGR
CAFPLFALMAGCNLAGRQIRQAAVNRLWLMAVLAQPVFWLAFCGTGNQWWELNILFCFAV
VMQVVCFWQRPDAIKGAITGTMLALYLPFSTASYGWQGLVMLLAAVSVWQVPEQYQGRLF
LLWLCSVVWLNGANGAVPVLAGMGMTLLVLCLVHEYVPSSSKRLQISRWFAEGYVLHLLI
IAVIVYGLQT
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccaggaatgtttctgcaaggatgatgtacggaatcccggtgctttgcctttg
ctgtctctggcaccattacaacgtgacattatcaaaatcgtggcatttctggcgatgaca
ggtgaccacattgctacagcatttcatgtggggactccctggcttaacctgaccgggcgg
tgcgcattcccacttttcgcactgatggcgggctgcaacctggcggggcggcagatacga
caggctgccgtaaatcgcctgtggctgatggcagtgctggcgcaaccggtattctggctg
gcattttgtggtacaggaaatcagtggtgggaactgaacattctgttctgctttgccgtg
gtgatgcaggtggtctgtttctggcaacgccctgatgccataaaaggtgccataaccgga
accatgctggcactgtatctgccgttcagtactgccagttatggctggcagggactggtg
atgctgctggcagctgtatccgtctggcaggtgccggagcagtaccaggggcggttattt
ttactgtggctgtgctctgttgtatggctgaacggtgcaaacggggcagtccccgtgctg
gccggtatgggcatgacactgctggtattgtgtctggtgcatgagtatgtaccttcatca
tcaaagcgcctgcagataagccggtggtttgcagaaggttatgtcctgcatctgctgatt
attgccgtcattgtttatgggctgcagacttaa

DBGET integrated database retrieval system