KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_0544
Entry
ECS88_0544        CDS       T00830                                 
Name
(GenBank) Putative antirepressor from phage
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
SSDB
Motif
Pfam: Phage_pRha Phage_ASH AIRC
Other DBs
NCBI-ProteinID: CAR01889
UniProt: B7ME66
Position
565935..566801
AA seq 288 aa
MIRNIFKLFTNRHQHIDSAIPGRYTVQAPYKAGAGIGVLKFAHAHNRASAVFLRTFPHIQ
IMVGRAGASKDAPGSCATGYANPVRLTTSVIGVPCGEFSKFAHEDVTMATTPTQTHPKID
VIHGKAVTSSLAVAEYFCKQHKNVIQKIQTLECSVEFTELNFQPSDYTDCTGRKLPCYQI
TRDGFAFLAMGFTGKRAARFKEAYINAFNQMEKQLSNPSVLSDVAHNASVLYSYISSIHQ
VWLQQLYPMLAKAESPLAVSLYDYINDASALACLINLSLNPSEVRGRK
NT seq 867 nt   +upstreamnt  +downstreamnt
atgatccggaatattttcaaactgtttaccaatcgccaccagcatattgattctgcaatt
ccgggacgttacactgttcaggcaccttataaagcgggtgccgggattggcgtcctgaaa
ttcgcacatgcgcataaccgcgcttcagcggtttttttgcgcacgtttcctcacatccaa
attatggtggggcgtgcaggggcatcgaaagatgcgccggggtcatgtgcgaccggttac
gccaaccctgtacgtctcaccacctctgtgattggcgtcccatgtggtgagttttcaaaa
ttcgcacatgaggatgtcactatggcaaccacccctacccaaactcaccctaaaattgat
gttatccatgggaaggctgttacctcttctttggccgttgccgaatatttctgcaagcag
cacaaaaacgttattcaaaaaatccagacgcttgagtgctctgttgaattcactgagctg
aattttcagcccagtgattacaccgattgcacaggccgcaaactcccttgttaccaaatc
acccgcgacggttttgcgtttcttgccatgggcttcacggggaaacgtgctgcccggttc
aaagaggcatacatcaatgcctttaaccagatggagaaacagctttcaaatccctctgta
ctgagcgacgttgcacataacgccagcgttctctattcctacatttcatcaattcatcag
gtctggctgcagcagctttatcctatgttggcaaaagccgaatctccgctggctgttagc
ttgtatgactatattaatgatgcttcggcgctggcctgcctcataaatttgtcgctgaat
ccttcagaggtaagggggcgtaaatga

DBGET integrated database retrieval system