KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_0055Help
Entry
ECS88_0055        CDS       T00830                                 

Gene name
apaG
Definition
(GenBank) protein associated with Co2+ and Mg2+ efflux
  KO
K06195  ApaG protein
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ECS88_0055 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: CAR01421
UniProt: B7MAH5
Position
complement(54426..54803)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQLLGRYWLITNGNGRET
EVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDENGVPFSIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgccccgagtgtgtattcaggttcaaagcgtctacattgaggcccaatct
tcacctgataatgaacgttacgtttttgcttataccgtaaccatacgcaatctggggcga
gcgccagtgcagttgttggggcgttactggctgatcaccaatggcaatggccgtgaaacc
gaagtccagggcgaaggagtggttggcgtccagccacttatcgcgcctggcgaagagtac
cagtacaccagcggtgcaatcattgaaaccccgctgggcaccatgcagggtcactacgaa
atgatcgatgaaaatggcgtccctttcagcatcgacattcccgtattccgactcgccgtt
cccacactcattcattaa

DBGET integrated database retrieval system