KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_0246
Entry
ECS88_0246        CDS       T00830                                 

Definition
(GenBank) conserved hypothetical protein Aec17
  KO
K11901  type VI secretion system protein ImpB
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecz02044]
    ECS88_0246
Secretion system [BR:ecz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECS88_0246
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAR01601
UniProt: B7MC61
Position
complement(262530..263084)
AA seq 184 aa
MYAVRKCCAHGLNGNIFMSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGN
LKGKPDNTPLDERTAIAINRYNLNAVISEADIEREFVVPAELSDAPNEQMYVNLKVKSMD
DLSPDHIASQVPEIKRLLELREALVALKSPLGNIPAFRAQLQALLENEDTREQLIQELGI
AVQK
NT seq 555 nt   +upstreamnt  +downstreamnt
ttgtatgcagtacgaaaatgctgtgctcatggcctgaacgggaacatttttatgagcaaa
atgaacaacaatggcggcagtgtcgcgccgaaagaaagaatcagcgttcggtatacacca
aaagttgatggggtggctgctgatatcgaattgccgctgaatttattgatcaccggcaat
ctgaaagggaaaccagataacacgccgttggatgagcgaactgccattgctatcaaccgc
tataacctcaacgcagtcatttcagaagctgacattgaacgggagtttgttgttccggct
gaactcagtgacgctcccaatgagcaaatgtacgtcaacctgaaagtcaaatctatggat
gacctttctcctgaccatattgccagccaggtaccagaaataaaacgtctgctcgaattg
cgtgaagccctagtcgcacttaagtctccactaggcaatattccagccttccgcgcacaa
cttcaggcgctactggaaaacgaagacacccgcgagcagctgatccaggaactgggtatc
gccgttcagaaataa

DBGET integrated database retrieval system