KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_0485Help
Entry
ECS88_0485        CDS       T00830                                 

Gene name
copA
Definition
(GenBank) copper transporter
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Brite
Enzymes [BR:ecz01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     ECS88_0485 (copA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Hydrolase HMA Hydrolase_3 HAD HAD_2 CstA_5TM DNA_photolyase
Motif
Other DBs
NCBI-ProteinID: CAR01831
UniProt: B7ME09
Position
complement(513684..516188)
Genome map
AA seq 834 aa AA seqDB search
MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVEQADVSITEAHVTGTASAEQLIETIKQAG
YDASVSHPKAKPLAESSIPSEALTAVSEALPAATADDDDSQQLLLSGMSCASCVTRVQNA
LQSVPGVTQARVNLAERTALVMGSASPQDLVQAVEKAGYGAEAIEDDAKRRERQQETAVA
TMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTADNRSLWLVIGLITLAVMVFAGGHFYRS
AWKSLLNGAATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGH
MLEARARQRSSKALEKLLDLTPPTARLVTDEGEKNVPLADVQPGMLLRLTTGDRVPVDGE
ITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVLFRASAVGSHTTLSRIIRMVR
QAQSSKPEIGQLADKISAVFVPVVVVIALISAAIWYFFGPAPQIVYTLVIATTVLIIACP
CALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTVVFDKTGTLTEGKPQVVAVKT
FADVDEAQALRLAAALEQGSSHPLARAILDKAGDMQLPQVNGFRTLRGLGVSGEAEGHAL
LLGNQALLNEQQVDTKAIEAEITAQASQGATPVLLAVDGKAVALLAVRDPLRSDSVAALQ
RLHKAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDGKAEAIKRLQSEGRQVAMVGD
GINDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLMGVADALAISRATLRNMKQNLLG
AFIYNSIGIPVAAGILWPFTGTLLNPVVAGAAMALSSITVVSNANRLLRFKPKE
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaactatcgacctgaccctggacggcctgtcctgcggtcactgcgttaaacgc
gtgaaagaaagtctcgaacagcgcccggatgttgaacaggcggatgtgtctatcactgaa
gcgcacgttaccgggactgccagtgcagaacagctgatcgaaaccatcaaacaagcgggt
tatgacgcatctgtaagccacccaaaggctaaaccgctggcggagtcatcaatcccgtcg
gaagcactgacagcggtttctgaggcgcttccggcagcgaccgccgatgacgatgacagc
cagcagttgctgctgagcggcatgagctgcgccagctgtgtcacccgcgtacaaaatgcg
ttgcaaagcgtaccgggcgtcactcaggcacgggtaaacctggcggagcgtactgcgctg
gtgatgggcagcgcctccccacaagatttagtgcaggcggtggaaaaagcgggctacggc
gcggaagcgattgaagatgacgctaaacgccgcgaacgccagcaagaaaccgccgtcgct
acgatgaagcgcttccgctggcaggcaattgtcgcactggcggtgggtatcccggtgatg
gtctgggggatgatcggcgataacatgatggtcaccgccgacaaccgcagcctgtggttg
gttatcggcctgataaccctggcggtaatggttttcgccggcgggcatttttaccgcagc
gcatggaaaagcctgctgaacggtgcagcgacgatggatacgctggtggcgctgggtact
ggcgtggcgtggctctattcgatgagcgtcaacctgtggccgcagtggttcccgatggaa
gcgcgacatctttattacgaagccagcgcgatgattattggtctgatcaatctcggccat
atgctggaagcgcgcgcgcgtcagcgttcttctaaggcgttggagaaattactcgattta
accccaccgacggcgcgcctggtcaccgacgaaggtgaaaaaaacgtgccgctggcagat
gttcagccaggtatgttactgcgcctgacgaccggcgaccgtgtgccggtagatggtgag
attactcaaggcgaagcgtggctggatgaagcgatgctgacgggcgaacctatcccgcag
caaaaaggcgaaggcgatagcgtccatgccgggacagtggtgcaggacggtagcgtgctg
tttcgcgccagtgcggttggcagccatactacgctgtcgcggattattcgtatggtgcgc
caggcccagagcagtaagccagaaatcggtcagctggcggataaaatctcagccgtattt
gtgccggtagtggtggtgattgcgctgatcagtgcggcaatctggtatttctttggtccg
gcaccgcagattgtctacaccctggtgattgccaccacggtgctgattattgcctgtccg
tgtgcgctggggctggcgacgccgatgtcgattatttcgggcgtcgggcgggcggctgag
tttggcgtgctggtacgggacgccgacgcgctgcaacgcgccagtacgctcgacaccgta
gtgttcgataaaaccgggacgctgaccgaaggtaaaccgcaggttgtcgcagtaaaaacg
tttgctgatgttgatgaagcgcaagcattgcgtctggcggcggcgctggagcaaggttcc
agccatccgctggcacgagcgatcctcgataaagcaggtgatatgcagctgccgcaggtc
aacggtttccgcacattgcgcgggctgggcgtgagcggtgaagctgaaggtcatgcgtta
ttgctgggtaatcaggcgttgttaaatgagcaacaggttgataccaaagctatcgaagcg
gagattactgctcaggcatcgcaaggggcaacgcctgtgctgctggcggttgacgggaaa
gcggtagccctgctggctgtacgcgatccattgcgtagtgatagcgtggcggcgctgcaa
cgcctgcataaagcgggatatcgcctggtgatgctaaccggggataacccgaccaccgcc
aatgcgatcgctaaagaagcagggattgatgaggtgatagccggcgtgctgccggacggt
aaagccgaagcgatcaaacgtctgcaaagtgaaggacgtcaggtagcaatggtgggcgac
ggcattaacgatgcgccagcgctggctcaggcggatgtcggtattgcgatggggggcggc
agtgatgttgccattgaaaccgcggcgattaccctgatgcgccatagcctgatgggtgtt
gcggatgcgctcgcaatttcccgcgcaacgctgcgcaacatgaagcagaacctgctcggt
gcgtttatctacaacagcattggtattccggtcgccgccggtattttgtggccgttcact
ggaacactgcttaacccggtggttgccggagcggcaatggcgctctcgtcgatcaccgta
gtgagtaacgccaaccgcttgctgcggtttaaaccgaaggaataa

DBGET integrated database retrieval system