KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_0748Help
Entry
ECS88_0748        CDS       T00830                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, membrane subunit, binds cytochrome b556
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00020  Citrate cycle (TCA cycle)
ecz00190  Oxidative phosphorylation
ecz00650  Butanoate metabolism
ecz01100  Metabolic pathways
ecz01110  Biosynthesis of secondary metabolites
ecz01120  Microbial metabolism in diverse environments
ecz01130  Biosynthesis of antibiotics
ecz01200  Carbon metabolism
Module
ecz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECS88_0748 (sdhD)
   00650 Butanoate metabolism
    ECS88_0748 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ECS88_0748 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAR02087
UniProt: B7MFX8
Structure
PDB: 

Position
763180..763527
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgt
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggccttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system