KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_0935Help
Entry
ECS88_0935        CDS       T00830                                 

Gene name
serC
Definition
(GenBank) 3-phosphoserine/phosphohydroxythreonine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00260  Glycine, serine and threonine metabolism
ecz00680  Methane metabolism
ecz00750  Vitamin B6 metabolism
ecz01100  Metabolic pathways
ecz01120  Microbial metabolism in diverse environments
ecz01130  Biosynthesis of antibiotics
ecz01200  Carbon metabolism
ecz01230  Biosynthesis of amino acids
Module
ecz_M00020  Serine biosynthesis, glycerate-3P => serine
ecz_M00124  Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ECS88_0935 (serC)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECS88_0935 (serC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ECS88_0935 (serC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecz01007]
    ECS88_0935 (serC)
Enzymes [BR:ecz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     ECS88_0935 (serC)
Amino acid related enzymes [BR:ecz01007]
 Aminotransferase (transaminase)
  Class V
   ECS88_0935 (serC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CAR02267
UniProt: B7MHL6
Structure
PDB: 

Position
964715..965803
Genome map
AA seq 362 aa AA seqDB search
MAQIFNFSSGPAMLPAEVLEQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDL
LNVPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFD
AKVTVDGLRAVKPMSEWQLSDNAAYMHYCPNETIDGIAIDETPDFGKDVVVAADFSSTIL
SRPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNDSMFNT
PPTFAWYLSGLVFKWLKANGGVAAMDKINQQKAELLYGVIDNSDFYRNDVAKANRSRMNV
PFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEFERR
HG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaatcttcaattttagttctggtccggcaatgctaccggcagaggtgcttgaa
caggctcaacaggaactgcgcgactggaacggtcttggtacgtcggtgatggaagtgagt
caccgtggcaaagagttcattcaggttgcagaggaagccgagaaggattttcgcgatctt
cttaacgtcccctccaactacaaggtattgttctgccatggcggtggtcgcggtcaattt
gctgctgtaccgctgaatattcttggtgataaaaccactgcagattatgttgatgcgggt
tactgggcagcaagtgctatcaaagaagcgaaaaaatactgcacaccaaatgtgtttgat
gcgaaagtgaccgttgatggtcttcgcgcagttaagccaatgagtgaatggcaactctct
gataatgctgcttatatgcattactgcccgaacgaaaccattgacggtatcgctatcgat
gaaacaccagacttcggtaaagacgtggtggtcgccgctgacttctcttcaaccattctt
tcccgtccgattgatgtcagccgttatggtgtaatttacgctggcgcgcagaaaaatatc
ggcccggctggcctgacaatcgtcatcgttcgtgaagatttgctgggcaaagcgaatatc
gcctgcccatcgattctggattactccatcctcaacgataacgattccatgttcaacacg
ccgccgacatttgcctggtacttatctggcctggtcttcaaatggctgaaagcgaacggc
ggtgtggctgcaatggataagatcaatcagcaaaaagcagaactgctgtatggggtgatt
gataacagcgatttctaccgcaatgatgtggcgaaagctaaccgttcgcggatgaacgtg
ccgttccagttggcggatagcgcgcttgataaattgttcctcgaagagtctttcgctgcg
ggcttacatgcgctgaaaggtcaccgagtggtcggcggaatgcgtgcgtctatttataac
gccatgccgctggaaggtgttaaagcactgacagacttcatggttgagttcgaacgtcgt
cacggctaa

DBGET integrated database retrieval system