KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_0977
Entry
ECS88_0977        CDS       T00830                                 

Gene name
ycbG
Definition
(GenBank) conserved hypothetical protein
  KO
K09911  uncharacterized protein
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ECS88_0977 (ycbG)
SSDB
Motif
Pfam: MatP MatP_C RHH_4 TMF_TATA_bd
Other DBs
NCBI-ProteinID: CAR02309
UniProt: B7MIA9
Structure
PDB: 
4D8J

Position
1018361..1018813
AA seq 150 aa
MKYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQEAVDELLSLENEPVLVNGWIDK
HMNPELVNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFIVWQRLAGLAQRRGKTLSETIV
QLIEDAENKEKYANKMSSLKQDLQALLGKE
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaatatcaacaacttgaaaatcttgaaagcggttggaaatggaagtatctggtgaag
aagcaccgcgaaggggagttaatcacccgttacatagaagccagtgccgcccaggaagcc
gtcgatgagttgctctcgctggaaaatgaacccgtgctggtaaatggttggattgacaag
catatgaatccggaactggtcaatcgcatgaagcagaccattcgggccagacggaagcgc
cattttaatgcagaacaccagcatacgcgcaaaaaatcgatcgatctggaatttatcgtc
tggcaacgtctggctggccttgcgcagcgtcgcggtaaaacgctttctgaaacgattgtt
cagctgattgaagatgcggaaaacaaagagaaatacgcgaataaaatgtcttctttgaag
caggatctgcaggcattgctgggtaaggaataa

DBGET integrated database retrieval system