KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_1511Help
Entry
ECS88_1511        CDS       T00830                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase A, NAD-linked
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00620  Pyruvate metabolism
ecz00630  Glyoxylate and dicarboxylate metabolism
ecz01100  Metabolic pathways
ecz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECS88_1511 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    ECS88_1511 (aldA)
Enzymes [BR:ecz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     ECS88_1511 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     ECS88_1511 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 LuxC
Motif
Other DBs
NCBI-ProteinID: CAR02829
UniProt: B7MMQ2
Structure
PDB: 

Position
1505145..1506584
Genome map
AA seq 479 aa AA seqDB search
MSVPVQHPMYIDGQFVTWRGDAWIDVVNPATEVVISRIPDGQAEDARKAIDAAERAQPEW
EALPAIERASWLRKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWAR
RYEGEIIQSDRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEF
TPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMAT
AAKNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKSIYDQ
FVNRLGEAMQAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVALGGKAVEG
KGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEEAISMANDSDYGLTSSIYTQNL
NVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacccgttcaacatcctatgtatatcgatggacagtttgttacctggcgtgga
gacgcatggattgatgtggtaaaccctgctacagaggttgtcatttcccgcattcccgat
ggtcaggccgaggatgcccgtaaggcaatcgatgcagcagaacgtgcacaaccagaatgg
gaagcgttgcctgctattgaacgcgccagttggttgcgcaaaatctccgccgggatccgg
gaacgtgccagtgaaatcagtgcgctgattgtcgaagaagggggcaagatccagcagttg
gctgaagtcgaagtggcttttactgcggactatatcgattatatggcggagtgggcacgg
cgttacgagggcgagattattcaaagcgatcgtccaggagaaaatatccttctgtttaaa
cgtgcgcttggcgtgactaccggcattctgccgtggaactttccgttcttcctcattgcc
cgcaaaatggctcccgctcttttgaccggtaataccatcgtcattaaacccagtgaattt
acgccaaacaatgcgattgcattcgccaaaatcgttgatgaaataggccttccgcgcggc
gtgtttaaccttgtactcgggcgtggtgaaaccgttgggcaagaactggcgggtaaccca
aaggtcgcaatggtcagtatgacaggcagcgtctctgcaggtgaaaagattatggcgact
gcggcgaaaaacatcaccaaagtgtgcctggaattggggggtaaagcaccggctatcgta
atggacgatgccgatcttgaactggcagtcaaagccatcgttgattcacgcgtcattaat
agtgggcaagtgtgtaactgtgcagaacgtgtttatgtacagaaaagcatttatgatcag
ttcgtcaatcggctgggggaagcgatgcaggcggttcaatttggtaaccccgctgaacgc
aacgacattgcgatgggaccgttgattaacgccgcggcgctggaaagggttgagcaaaaa
gtggcgcgcgcagtagaagaaggggcgagagtggcgttgggtggcaaagcggtagagggg
aaaggatattattatccgccgacattgctgctggatgttcgccaggaaatgtcgattatg
catgaggaaacctttggcccggttctgccggtggtcgcatttgacacgctggaagaggct
atctcaatggctaatgacagtgattacggcctgacctcatcaatctatacccaaaatctg
aacgtcgcgatgaaagccattaaagggctgaagtttggtgaaacttacatcaaccgtgaa
aacttcgaagctatgcaaggcttccacgctggatggcgtaaatccggtattggcggcgca
gatggtaaacatggcttgcatgaatatctgcagacccaggtggtttatttacagtcgtaa

DBGET integrated database retrieval system