KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_1874Help
Entry
ECS88_1874        CDS       T00830                                 

Gene name
rrmA
Definition
(GenBank) 23S rRNA m1G745 methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ecz03009]
    ECS88_1874 (rrmA)
Enzymes [BR:ecz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     ECS88_1874 (rrmA)
Ribosome biogenesis [BR:ecz03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ECS88_1874 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 MTS Ubie_methyltran Methyltransf_4 Methyltransf_32 MetW PrmA DUF938 Methyltransf_2 Methyltransf_29 PCMT Methyltransf_8 Methyltransf_9 Pox_MCEL Rad50_zn_hook NodS
Motif
Other DBs
NCBI-ProteinID: CAR03180
UniProt: B7MBM8
Structure
PDB: 

Position
complement(1861373..1862182)
Genome map
AA seq 269 aa AA seqDB search
MSFSCPLCHQPLSREKNSYICPQRHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMMQARRA
FLDAGHYQPLRDAIVGQLRERLDEKAAAVLDIGCGEGYYTHAFADALPEITTFGLDVSKV
AIKAAAKRYPQVTFCVASSHRLPFSDTSMDAIIRIYAPCKAEELVRVVKPGGWVITATPG
PRHLIELKGLIYNEVHLHAPHAEQLKGFTLQQSDELCYLMRLRGDEAVALLQMTPFAWRA
KPEVWQALAAKEVFDCQTDFNIHLWQRSY
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttcctgtccactttgccatcagcctctttcgcgtgaaaaaaacagctatatc
tgtccccagcgacatcagtttgatatggcgaaagaagggtatgtcaatctgctgcccgtt
cagcataaacggtctcgtgatccgggcgacagcgcggaaatgatgcaagcacgccgcgca
ttcttagatgccggacattatcagccgctgcgtgatgcaattgtcggccaattgcgggaa
cggcttgatgaaaaggccgcggcggtgctggatattggctgtggtgaagggtattacaca
cacgcatttgctgatgcgttgcccgaaatcaccacgtttggcctggatgtctcgaaggta
gcgataaaagcggcggcgaaacgctatccgcaggtcactttttgtgtcgcttccagccac
cgtttgccgttctccgataccagtatggacgccataatacgtatttacgcgccgtgtaaa
gcagaagaattagtgcgagtagtgaagcccggcggttgggtcattactgccacgccggga
ccgagacacttaattgagctgaaggggctgatttacaatgaagtacatcttcatgcacct
catgcagaacaactgaaaggttttacattacagcagagtgatgagttgtgttatctgatg
cgtcttcgcggtgatgaagccgtcgcattattgcagatgacgccgtttgcctggcgtgcg
aagcctgaagtctggcaagcactggcagcaaaagaagtgttcgactgccagacggacttt
aatattcacctctggcagcgttcttattaa

DBGET integrated database retrieval system