KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_2020Help
Entry
ECS88_2020        CDS       T00830                                 

Gene name
yedV
Definition
(GenBank) sensory kinase in two-component regulatory system with YedW
  KO
K02484  two-component system, OmpR family, sensor kinase [EC:2.7.13.3]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecz01001]
    ECS88_2020 (yedV)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecz02022]
    ECS88_2020 (yedV)
Enzymes [BR:ecz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ECS88_2020 (yedV)
Protein kinases [BR:ecz01001]
 Histidine kinases
  OmpR family
   ECS88_2020 (yedV)
Two-component system [BR:ecz02022]
 OmpR family
  Unclassified
   ECS88_2020 (yedV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 DUF5452 COP-gamma_platf
Motif
Other DBs
NCBI-ProteinID: CAR03318
UniProt: B7MCM1
Position
complement(1991246..1992604)
Genome map
AA seq 452 aa AA seqDB search
MKRLSITVRLTLLFILLLFVAGAGIVWTLYNGLASELKWRDDTTLINRTAQIKQLLIDGV
NPDTLPVYFNRMMDVSQDILIIHGDGINKIVNRTNVSNGMLNNIPASETISAAGIYRSII
NDTEIDALRINIDEVSPSLTVTVAKLASARHNMLEQYKINSIIICIVAIILCSVLSPLLI
RTGLREIKKLSGVTEALNYNDSREPVEVSALPRELKPLGQALNKMHQALVKDFERLSQFA
DDLAHELRTPINALLGQNQVTLSQTRSIAEYQKTIAGNIEELENISRLTENILFLARADK
NNVLVKLDSLSLNNEVENLLDYLEYLSDEKEICFKVECNQHIFADKILLQRMLSNLIVNA
IRYSPEKSRIQITSFLDTNGSLNIDIASPGTKIHEPEKLFRRFWRGDNSRHSVGQGLGLS
LVKAIAELHGGSATYHYLSKHNVFRITLPQRN
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagattatctataaccgtccgtttaaccttgctttttatattgctgctgtttgtt
gctggcgctggaattgtctggactctctataatggcctggcaagtgagttgaaatggcgc
gatgatacaacactcattaaccggacagcgcagatcaagcagttgttaattgatggggta
aatccagatacgttacctgtgtactttaaccggatgatggatgttagtcaggatatcttg
atcattcatggtgatggcatcaataaaattgttaaccggacaaatgtcagtaatggcatg
ttaaataacatacctgctagtgagacaatcagcgcagctggcatttacagaagcattatt
aatgacacagagatagatgctttacgaattaatattgatgaagtttcgccatcattaacg
gttactgtggctaaattggcttcagccagacataacatgcttgaacagtataaaattaat
agcattataatttgcattgtcgccattatactgtgctcagtattaagtccgttgttaatc
agaacggggttacgagagatcaaaaagttgagtggtgtaacggaagcgctgaattataac
gatagccgagagcctgttgaggttagcgcattaccgagagaactaaaacctcttgggcag
gcgttgaataaaatgcaccaagctttagtcaaagattttgaacgtctaagtcagtttgct
gacgatctcgctcatgaacttagaacgccaattaatgcattactgggtcagaatcaggtt
acgctcagtcaaaccagaagtatcgctgaatatcaaaaaacaattgccggaaacattgaa
gagctggaaaatatttcgcgattaacagagaacatactgtttcttgccagggcagataaa
aataatgttttggtgaaactggactcgctttctctcaataatgaagtcgaaaatttgttg
gactatcttgaatacctttcagacgagaaagagatttgctttaaggtcgagtgcaatcag
cacatctttgcggataaaattttactacaacgaatgttatcgaatcttattgttaacgct
attcgatattcgccagaaaaatcgcgtattcagataaccagttttcttgataccaacggt
tctcttaatattgatatcgccagtcctggaacgaaaattcatgagcctgaaaaactcttc
cgtagattttggcggggagataattcgcgtcattccgtaggtcagggacttggtctttct
ttagtcaaagcgattgccgaattacatgggggaagtgctacgtatcactatctcagtaag
cataatgtgttccggattacgttaccgcaaagaaattaa

DBGET integrated database retrieval system