KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_2393
Entry
ECS88_2393        CDS       T00830                                 

Gene name
yfaU
Definition
(GenBank) putative 2,4-dihydroxyhept-2-ene-1,7-dioic acid-like aldolase
  KO
K12660  2-dehydro-3-deoxy-L-rhamnonate aldolase [EC:4.1.2.53]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00051  Fructose and mannose metabolism
ecz01100  Metabolic pathways
ecz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECS88_2393 (yfaU)
Enzymes [BR:ecz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.53  2-keto-3-deoxy-L-rhamnonate aldolase
     ECS88_2393 (yfaU)
SSDB
Motif
Pfam: HpcH_HpaI PK
Other DBs
NCBI-ProteinID: CAR03673
UniProt: B7MG11
Structure
PDB: 
2VWS 2VWT

Position
complement(2389885..2390688)
AA seq 267 aa
MNALLTNPFKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQ
LQAVAPYASHPVIRPVEGSKPLIKQVLDIGAQTLLIPMVDTADQARQVVSATRYPPYGER
GVGASVARAARWGRIENYMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADL
SASLGYPDNAGHPEVQRIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDT
MLYSDALDQRLAMFKSGKNGPRVKGSY
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaacgcattattaaccaatccctttaaagaacgtttacgcaagggcgaagtgcaaatt
ggtctgtggttaagctcaacgactgcctatatggcagaaattgccgccacttccggttat
gactggttgctgattgacggggagcatgcgccaaacaccattcaggatctttatcaccag
ctacaggcggtagcgccctatgccagccaccccgtgatccgtccggtggaaggcagtaag
ccgctgattaaacaagtcctggatattggcgcgcaaactctactgatcccgatggtcgat
actgccgatcaggcacgtcaggtggtgtctgccacgcgctatcctccctacggtgagcgt
ggtgttggggccagtgtggcacgggctgcacgctggggacgcattgagaattacatggcg
caagtcaacgattcgctttgtctgttggtgcaggtggaaagtaaaacggcactggataac
ctggacgaaatcctcgatgttgaagggattgatggcgtgtttattggacctgcggatctt
tctgcgtcgttgggctacccggataacgccgggcacccggaagtgcagcgaattattgaa
accagcattcggcggatccgtgctgcgggtaaagctgctggttttctggctgtggctcct
gatatggcgcagcaatgcctggcgtggggagcgaactttgtcgctgttggcgttgacacg
atgctctacagcgatgccctggatcaacgactggcgatgtttaaatcaggcaaaaatggg
ccacgcgtaaaaggtagttattga

DBGET integrated database retrieval system