KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_3083
Entry
ECS88_3083        CDS       T00830                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecz02044]
    ECS88_3083
Secretion system [BR:ecz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECS88_3083
SSDB
Motif
Pfam: T6SS_VipA GerD Imm65
Other DBs
NCBI-ProteinID: CAR04324
UniProt: B7MLD5
Position
3034518..3035039
AA seq 173 aa
MDDEEKDMADSFQNEVPTARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSER
DKVDINKNNFNSVMAEFSPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQL
RVLLAMRNLLRDLKSNLLDNATFRRELENILKDPTLSSELRDELAKIAPQENV
NT seq 522 nt   +upstreamnt  +downstreamnt
gtggatgatgaggaaaaggatatggctgacagtttccagaatgaagttcccaccgctcgt
gtaaatatcaagcttgatctgcatacaggcaatgctaaaaagaaagttgaactccccctc
aagcttcttgccgtaggcgattacagtaacggaaaagagcaacgtccgctgtccgaacgg
gacaaggttgatatcaataaaaacaacttcaacagcgtcatggctgagttttcgcctgcg
gttaatttaacagtagaagatacgctaaacggaaacggtaatgaacaaaatatcgcgctt
gaatttaaaagcctgaaggattttgaacccgaacaggtagcaaaaaatattccgcaactt
cgtgtattactcgctatgcgcaatttactacgtgacctgaaatccaatctgctggataac
gcaacgtttcgccgtgaactggaaaatattctgaaagacccgacgctcagttcagaactg
cgtgatgaactggcgaaaattgcgccgcaggagaacgtttaa

DBGET integrated database retrieval system