KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_3105Help
Entry
ECS88_3105        CDS       T00830                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecz02044]
    ECS88_3105
Secretion system [BR:ecz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECS88_3105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: CAR04345
UniProt: B7MLF6
Position
3062479..3062907
Genome map
AA seq 142 aa AA seqDB search
MSTPSLYEMLTFSFSGELPLEQISERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLS
LIHQGMAAGIHGLMRQIEETLLRYEPRLSQIQVELLPQPRPGHLNYLIHAQLPDTGWIRF
DGVFSPEGRIVLRHLKQQERAY
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaccttccttatatgaaatgctgacgttcagtttcagcggcgagttaccgctg
gaacagatcagcgagcgggatcagcttatcctttccgtgatggacaatatgcaacgcatt
atcaactgccgggcaggcacgctggcgcatttgccggattacggtctgccggatctcagt
ctgatccatcaggggatggctgcgggtattcatggcctgatgcgtcagattgaagaaaca
ctgctgcgttatgaaccacgcctgagtcagatacaggtggaattactcccccagccccgt
ccggggcatcttaattacctgatccacgcgcagcttcccgataccggctggatacgcttt
gatggcgtattttctccggaaggacgaattgttctgcgtcatctcaaacagcaggagcgg
gcgtactga

DBGET integrated database retrieval system