KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_3145
Entry
ECS88_3145        CDS       T00830                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00230  Purine metabolism
ecz01100  Metabolic pathways
ecz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECS88_3145 (xdhA)
Enzymes [BR:ecz01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ECS88_3145 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C DUF4694
Other DBs
NCBI-ProteinID: CAR04382
UniProt: B7MM53
Position
3111070..3113328
AA seq 752 aa
MRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQARSLPGVLAIFTWE
DVPEIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARDELTAEKAAQLVSI
EWQELPVITSPEAALAEDAAPIHNGGNLLKQSTMSTGNVQQTIDAADYQVQGHYQTPVIQ
HCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVRVIKPFIGGGFGNK
QDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMGVNRDGTLKGYSLD
VLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAGAMRGYGAPQVVFA
VESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIYSAGLPECLEKGRKIFEWEKRR
AECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINVQSGATEIGQGADT
VFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPALRSAALLLKEKIIA
HAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERGGQLSAESSIKTTT
NPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHGGMGMGIGWALFEE
MIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKSLGEPPIIPVAAAI
RNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgcgcgtcgatgccattgctaaggtcaccgggcgagcacgatatactgacgattatgtt
atggcgggcatgtgttacgcgaaatatgtacgtagccctatcgcacatggttatgccgta
agtattaatgatgaacaagccaggagtttgccgggcgtcctggcgatttttacctgggaa
gatgtgccagaaatcccattcgccacggcagggcatgcctggacacttgacgaaaacaag
cgcgatactgccgatcgtgccctgctaacgcgccatgttcgtcatcatggcgacgccgtt
gccatcgtcgtggcccgcgatgaactcacggcagaaaaagcggcgcaattggtcagcatt
gagtggcaagaattacccgttatcacctcgccagaagcggcgctggcagaagacgctgca
ccaatccataacggtggcaatttactgaaacaaagcacgatgtcgacgggtaatgtccaa
caaacaatcgatgccgccgactaccaggtacaggggcactatcagactcccgttattcaa
cattgtcatatggaaagcgtgacatcgctggcatggatggaggatgactcgcgaattacc
atcgtttccagcacccagatcccgcacattgttcgccgcgtggttggtcaggcgctggat
attccctggtcatgcgtacgagtcatcaaaccgtttatcggtggcggttttggtaataaa
caggatgtactggaagagccaatggcagcattcctgaccagcaaacttggcggcattccg
gtgaaagtttcccttagccgtgaagagtgtttcctcgcaacccgtacccgccacgctttt
actattgacgggcaaatgggcgtgaaccgcgacggaacattgaaaggttatagtctggat
gttctgtctaacaccggcgcttatgcatctcacgggcactccattgcttctgctgggggg
aataaagtcgcttacctttatcctcgttgtgcctacgcttacagttcaaagacctgctat
accaacctcccctcggctggtgcgatgcgtggttatggcgcgccacaagtcgtatttgcc
gttgagtctatgcttgatgatgccgcgacagcgttaggtattgatcctgttgaaattcgt
ttacgcaacgccgcccgcgaaggagatgctaatccgctcacgggaaaacgtatttacagc
gcagggttgccggagtgtcttgaaaaaggccggaaaatctttgaatgggaaaaacgccgt
gcagagtgccagaaccagcaaggcaatttacgtcgtggcgttggcgtcgcctgttttagc
tacacctctaacacctggcctgtcggcgtagaaatagcaggcgcgcgcctgttgatgaat
caggatggaaccatcaacgtgcaaagcggcgcgacggaaatcggccagggtgccgacacc
gtgttctcgcaaatggtggcagaaaccgtgggagttccggtcagcgatgtccgcgtaatt
tcgacacaagacaccgacgttacaccattcgaccccggcgcatttgcctcacgtcagagc
tatgttgccgcgcctgcgctgcgcagtgcggcactgttattaaaagagaaaatcatcgct
cacgccgcagtcatgctacatcagtcagcgatgaatctgaccctgataaaaggccatatc
gtgctggttgaacgaccggaagagccgttaatgtcgttaaaagatttggcgatggacgct
ttctaccaccctgaacgcggcgggcagctctctgccgaaagctccatcaaaaccaccact
aacccacctgcgtttggctgtacctttgttgatctgacggtcgatattgcactgtgtaaa
gtcaccatcaaccgcatcctcaacgttcatgattcgggccatattcttaatccgctgctg
gcagaaggtcaggtacacggcggaatgggaatgggcattggctgggcgctatttgaagag
atgatcatcgatgcgaaaagcggcgtggtccgtaaccccaatctgctggattacaaaatg
ccgaccatgccggatctgccacaactggaaagcgcgttcgtcgaaatcaatgagccgcaa
tccgcatacggacataagtcactgggtgagccacccataattcctgtagccgctgctatt
cgtaacgcggtgaagatggctaccggtgttgcaatcaatacactgccgctaacgccaaaa
cgattatatgaagaattccatctggcaggattgatttga

DBGET integrated database retrieval system