KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_3516Help
Entry
ECS88_3516        CDS       T00830                                 

Gene name
garD
Definition
(GenBank) (D)-galactarate dehydrogenase
  KO
K01708  galactarate dehydratase [EC:4.2.1.42]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00053  Ascorbate and aldarate metabolism
ecz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    ECS88_3516 (garD)
Enzymes [BR:ecz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.42  galactarate dehydratase
     ECS88_3516 (garD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GD_AH_C SAF
Motif
Other DBs
NCBI-ProteinID: CAR04744
UniProt: B7MB53
Structure
PDB: 

Position
3486828..3488399
Genome map
AA seq 523 aa AA seqDB search
MANIEIRQETPTAFYIKVHDTDNVAIIVNDNGLKAGTRFPDGLELIEHIPQGHKVALLDI
PANGEIIRYGEVIGYAVRAIPRGSWIDESMVVLPEAPPLHTLPLATKVPEPLPPLEGYTF
EGYRNADGSVGTKNLLGITTSVHCVAGVVDYVVKIIERDLLPKYPNVDGVVGLNHLYGCG
VAINAPAAVVPIRTIHNISLNPNFGGEVMVIGLGCEKLQPERLLTGTDDVQAIPVESASI
VSLQDEKHVGFQSMVEDILQVAECHLQKLNQRQRETCPASELVVGMQCGGSDAFSGVTAN
PAVGYASDLLVRCGATVMFSEVTEVRDAIHLLTPRAVNEEVGKRLLEEMEWYDNYLNMGK
TDRSANPSPGNKKGGLANVVEKALGSIAKSGKSAIVEVLSPGQRPTKRGLIYAATPASDF
VCGTQQVASGITVQVFTTGRGTPYGLMAVPVIKMATRTELANRWFDLMDINAGTIATGEE
TIEEVGWKLFHFILDVASGKKKTFSDQWGLHNQLAVFNPAPVT
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggccaacatcgaaatcagacaagaaacgccaactgcgttttatataaaagttcacgac
acagataatgtggcaattattgttaatgataatggcctgaaagcaggaacgcgttttccg
gatgggctggaattaattgaacatattccccaggggcataaagtcgcattgctggacatt
ccggctaatggtgaaattattcgttatggcgaggtgattggttacgccgtgcgcgcaatc
ccacgcggaagctggatcgacgaatcaatggttgtactaccggaagcgccgccgttacat
acactgccactggcaaccaaagtcccggaacccttaccgccgctggaaggatacaccttt
gagggctatcgcaatgccgatggcagcgtgggcaccaaaaacctgctcggcatcaccacc
agcgtccactgtgtggcaggcgtggtggactacgtagtaaaaatcattgaacgcgatctg
ctaccgaaatacccgaacgtcgatggcgtggtggggctgaatcatttgtacggttgtggc
gtggcgattaacgcacccgcggcagttgtacctattcgtaccattcacaatatttcgctg
aaccctaactttggcggcgaagtaatggtgattggtctgggttgtgaaaagttgcagcct
gaacgcctactgactggaacggatgatgtgcaagctattccagtagaaagcgccagcatt
gtcagtttgcaggatgaaaagcatgtcggttttcagtccatggtcgaggatattttgcag
gtcgccgaatgccatctacaaaaactgaatcaacgtcagcgagaaacctgtccggcttca
gaactggttgtcggcatgcagtgcggtggcagcgatgcgttttctggcgtaacggcaaac
ccggcggttgggtatgcgtctgatctattggtgcgctgcggcgcaacggtgatgttttca
gaagtcacagaagtgcgtgacgcgatacatctgctgacaccacgcgcagtgaacgaagag
gtcggcaaacggctgctggaggagatggagtggtacgataactatctcaatatgggaaaa
accgatcgcagcgccaacccttcgccggggaacaagaaaggcggtctggcaaatgtggtg
gagaaggcactcggctccattgctaaatcgggtaaaagtgcaattgttgaagtgctgtcg
cccggccaacgcccgactaaacgcggattaatttacgccgcgacgccagccagcgatttt
gtctgtggcacgcaacaggtggcttcgggtatcaccgtgcaagtgtttacgaccggtcgt
ggtacgccgtacggcctgatggcggtacccgtcattaaaatggcgacccgcaccgagctg
gcgaaccgctggtttgatttaatggatattaacgcgggcactatcgctaccggcgaagaa
accattgaagaagtgggctggaagttgttccactttattctcgacgtcgccagcgggaag
aagaaaactttctcggatcaatggggactgcataaccagctggcggtgtttaacccggca
ccggtgacctga

DBGET integrated database retrieval system