KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_3792Help
Entry
ECS88_3792        CDS       T00830                                 

Gene name
ompR
Definition
(GenBank) DNA-binding response regulator in two-component regulatory system with EnvZ
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz02020  Two-component system
ecz02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECS88_3792 (ompR)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    ECS88_3792 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecz02022]
    ECS88_3792 (ompR)
Two-component system [BR:ecz02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   ECS88_3792 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: CAR05006
UniProt: B7MDN1
Structure
PDB: 

Position
complement(3736069..3736788)
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaactacaagattctggtggttgatgacgacatgcgcctgcgcgcgctgctg
gaacgttatctcaccgaacaaggcttccaggttcgaagcgtcgctaatgcagaacagatg
gatcgcctgctgactcgtgaatctttccatcttatggtactggatttgatgttacctggt
gaagatggcttgtcgatttgccgacgtcttcgtagccagagcaatccgatgccgatcatt
atggtgacggcgaaaggggaagaagtggaccgtatcgttggcctggagattggcgctgac
gattacattccaaaaccgtttaacccgcgtgaattgctggcccgcattcgtgcggtgctg
cgtcgtcaggcgaacgaactgccaggcgcaccgtcacaggaagaggcggtaattgctttc
ggtaagttcaaacttaacctcggtacgcgcgaaatgttccgcgaagacgagccgatgccg
ctcaccagtggtgagtttgcggtacttaaggcgctggtcagccatccgcgtgagccgctc
tcccgcgataagctgatgaaccttgcccgtggtcgtgaatattccgcaatggaacgctcc
atcgacgtgcagatttcgcgtctgcgccgcatggtggaagaagatccggcgcatccgcgt
tacattcagaccgtctggggtctgggctacgtctttgtaccggacggttctaaagcatga

DBGET integrated database retrieval system