KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_4480Help
Entry
ECS88_4480        CDS       T00830                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00630  Glyoxylate and dicarboxylate metabolism
ecz01100  Metabolic pathways
ecz01110  Biosynthesis of secondary metabolites
ecz01120  Microbial metabolism in diverse environments
ecz01200  Carbon metabolism
Module
ecz_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ECS88_4480 (aceA)
Enzymes [BR:ecz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ECS88_4480 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CAR05641
UniProt: B7MIZ7
Structure
PDB: 

Position
4452165..4453469
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGE
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPANSVPAV
VERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDADAADL
ITSDCDPHDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGIHSMWF
NMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGTS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacacaacaaattgaagaattacagaaagagtggactcaaccgcgttgg
gaaggcattactcgcccgtacagcgcggaagatgtggtgaaattacgcggttcagtcaat
ccggaatgcaccctggcgcaactgggcgcggcgaaaatgtggcgtctgctgcacggcgag
tcgaaaaaaggctacatcaacagcctcggtgcactgactggtggtcaggcgctgcaacag
gcgaaagcgggtattgaagcagtctatctgtcgggatggcaggtagcggcggacgctaac
ctggcggccagcatgtatccggatcagtcgctctatccggcaaactcggtgccagcggtg
gtggagcggatcaacaatactttccgccgtgcggatcagatccaatggtccgcgggcatt
gagccgggcgatccgcgctatgtcgattacttcctgccgatcgtcgccgatgcggaggcc
ggttttggcggtgtactgaatgcctttgaactgatgaaagcgatgattgaagccggtgca
gcggcagttcacttcgaagatcagctggcatcagtgaagaaatgtggtcacatgggcggc
aaagttttggtgccaactcaggaagctattcagaaactggtcgcggcgcgtctggcagct
gatgtgacgggcgttccaaccctgctggttgctcgtaccgatgccgatgcggcggatctg
attacctccgattgcgacccacatgacagcgaatttattactggcgagcgtaccagtgaa
ggcttcttccgtactcatgcgggtattgagcaagcgatcagccgtggcctggcgtatgcg
ccatatgctgacctggtatggtgtgaaacctccacgccggacctggaactggcgcgtcgc
tttgcacaagccatccacgcgaaatatccgggcaaactgctggcttataactgctcgccg
tcgttcaactggcagaaaaacctcgacgacaaaactattgccagcttccagcagcagctg
tcggatatgggctacaagttccagttcatcaccctggcaggtatccacagcatgtggttc
aacatgtttgacctggcaaacgcctatgcccagggcgagggtatgaagcactatgttgag
aaagtgcagcagccggaatttgccgccgcgaaagatggctataccttcgtatctcaccag
caggaagtgggtacaggttacttcgataaagtgacgaccattattcagggcggcacgtcg
tcggttaccgcactgactggctccactgaagaatcgcagttctaa

DBGET integrated database retrieval system