KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_4492Help
Entry
ECS88_4492        CDS       T00830                                 

Definition
(GenBank) sorbose-specific phosphotransferase enzyme IIA component (PTS system)
  KO
K02812  PTS system, sorbose-specific IIA component [EC:2.7.1.206]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00051  Fructose and mannose metabolism
ecz01100  Metabolic pathways
ecz02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECS88_4492
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ECS88_4492
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecz02000]
    ECS88_4492
Enzymes [BR:ecz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     ECS88_4492
Transporters [BR:ecz02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    ECS88_4492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man STb_secrete HTH_DeoR
Motif
Other DBs
NCBI-ProteinID: CAR05653
UniProt: B7MJ09
Position
complement(4467274..4467681)
Genome map
AA seq 135 aa AA seqDB search
MVNAIFCAHGKLACAMLESVQMVYGDARVEAVEFVPGENAGDIVAKLEKLVSIHNHDEWL
IAVDLQCGSPWNAAAMLAMRNPRLRVISGLSLPLALELVDNQDSMNVDELCEHLTQIAKQ
TCVVWRQVATAEEDF
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatgccattttttgcgcccacggcaaattagcctgcgccatgctggaatcggtt
cagatggtgtacggcgatgccagggtcgaggcagttgaatttgtgcccggcgagaacgcc
ggagacattgtggcaaagctggagaagttagtgagcattcacaatcatgacgagtggcta
atcgccgtggatttacagtgcggcagcccgtggaatgcggcagcgatgcttgcgatgcgc
aatcctcgtctgcgggtaatcagcggcctttctctgccgctggcgctcgaactggttgat
aaccaggacagcatgaatgttgatgaactgtgtgaacacctgacgcaaatcgcaaagcaa
acctgcgtcgtctggagacaggtagcaacagcagaggaggatttctga

DBGET integrated database retrieval system