KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_4538Help
Entry
ECS88_4538        CDS       T00830                                 

Gene name
sucD
Definition
(GenBank) Succinyl-CoA synthetase alpha chain (SCS-alpha)
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00020  Citrate cycle (TCA cycle)
ecz00640  Propanoate metabolism
ecz00660  C5-Branched dibasic acid metabolism
ecz01100  Metabolic pathways
ecz01110  Biosynthesis of secondary metabolites
ecz01120  Microbial metabolism in diverse environments
ecz01130  Biosynthesis of antibiotics
ecz01200  Carbon metabolism
Module
ecz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECS88_4538 (sucD)
   00640 Propanoate metabolism
    ECS88_4538 (sucD)
   00660 C5-Branched dibasic acid metabolism
    ECS88_4538 (sucD)
Enzymes [BR:ecz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ECS88_4538 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: CAR05698
UniProt: B7MJ54
Position
4517912..4518784
Genome map
AA seq 290 aa AA seqDB search
MSVLINKHTRVLVQGITGKNGTFHTEQAIAYGTQIVGGVTPGKGGQRHLDRPVFDSMKEA
MRQTEADASVIYVPAPFVLDSVVEAIEAGVKLVVVITEGVPTLDMVKVRRLLDCHPDVRL
IGPNCPGVITPGECKIGIMPGEIHRPGRIGIVSRSGTLTYEAVAQTTALGLGQSTCIGIG
GDPVPGTNFIDALRLFENDPQTDAVIMIGEIGGNAEERAAEFIRHEMNKPVVGYIAGVTA
PKGKRMGHAGAIISGGSGSAEDKFRAFDKAGMAWTRNPALLGETLWNVIK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttttgatcaacaaacacacgcgggtactggtgcagggcattaccggcaaaaac
ggcacatttcatacagagcaggctattgcgtatggcacgcagattgtgggtggagtgacg
ccaggtaagggcgggcaacggcatctggatcgcccggtttttgattcaatgaaagaagcg
atgcgacaaactgaggctgatgccagcgtgatttatgtgcctgcaccgtttgtgctggat
tctgttgttgaggctattgaagctggcgtcaaattggttgtggtgatcactgaaggtgta
ccgacactggatatggtgaaagttcgtcggctgcttgactgccacccggatgtgcggctg
attgggccaaactgcccaggagttatcacgccgggcgagtgcaaaatcgggattatgcct
ggtgaaatccaccgcccagggcgtattgggattgtttcccgctccggtacattaacctac
gaagctgtagcgcaaaccacggcgctgggacttgggcaatccacctgtattggtattggc
ggcgatccggttccggggactaactttattgatgcgctgcgtttattcgaaaatgatccg
caaacagacgcggtaattatgatcggtgaaattggtggtaatgcggaagaacgggctgcg
gaatttattcgtcatgaaatgaataaaccggtcgtaggttatattgccggtgttactgca
ccaaaaggaaaacgcatggggcacgccggagccattatttctggcggtagcggcagtgca
gaggataaattccgtgcgttcgataaagcaggcatggcatggacaagaaacccggcgttg
cttggcgaaacgttatggaatgttattaagtaa

DBGET integrated database retrieval system