KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_4993Help
Entry
ECS88_4993        CDS       T00830                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III, psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00230  Purine metabolism
ecz00240  Pyrimidine metabolism
ecz01100  Metabolic pathways
ecz03030  DNA replication
ecz03430  Mismatch repair
ecz03440  Homologous recombination
Module
ecz_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ECS88_4993 (holD)
   00240 Pyrimidine metabolism
    ECS88_4993 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ECS88_4993 (holD)
   03430 Mismatch repair
    ECS88_4993 (holD)
   03440 Homologous recombination
    ECS88_4993 (holD)
Enzymes [BR:ecz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ECS88_4993 (holD)
DNA replication proteins [BR:ecz03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ECS88_4993 (holD)
DNA repair and recombination proteins [BR:ecz03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     ECS88_4993 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: CAR06135
UniProt: B7MNC2
Structure
PDB: 

Position
4951746..4952159
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSHCNSWRLGTDEPLSLEGAQVASPALTDLRANPTARAA
LWQQICTYEHDFFPRND
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggcattacccagtggtcgctgcgt
cgccctggcgcgttgcagggggagattgccattgcgatcccggcacacgtccgtctggtg
atggtggcaaacgatcttcccgccctgactgatcctttagtgagcgatgttctgcgcgca
ttaaccgtcagccccgaccaggtgctgcaactgacgccagaaaaaatcgcgatgctgccg
caaggcagtcactgcaacagttggcggttgggtactgacgaaccgctatcactggaaggc
gctcaggtggcatcaccggcgctcaccgatttacgggcaaacccaacggcacgcgccgcg
ttatggcaacaaatttgcacatatgaacacgatttcttccctcgaaacgactga

DBGET integrated database retrieval system